Tested Applications
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-11479 targets TIMM9 in IF/ICC applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2050 Product name: Recombinant human TIMM9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC020213 Sequence: MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR Predict reactive species |
Full Name | translocase of inner mitochondrial membrane 9 homolog (yeast) |
Calculated Molecular Weight | 89 aa, 10 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC020213 |
Gene Symbol | TIMM9 |
Gene ID (NCBI) | 26520 |
RRID | AB_3672499 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y5J7 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 TIMM9 antibody CL488-11479 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |