TIP30 Recombinant monoclonal antibody

• 

  WB analysis using 86972-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86972-1-RR (TIP30 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

TIP30 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86972-1-RR

Clone No.252091A12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

HTATIP2, 30 kDa HIV-1 TAT-interacting protein, CC3, EC:1.1.1.-, HIV-1 TAT-interactive protein 2

---

Tested Applications

• Positive WB detected in: HeLa cells, A431 cells, A549 cells, SW 1990 cells, A-673 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86972-1-RR targets TIP30 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0353

  Product name: Recombinant human TIP30 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 82-276 aa of BC002439

  Sequence: TLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP

• Full Name: HIV-1 Tat interactive protein 2, 30kDa
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 28 kDa, 32 kDa
• GenBank Accession Number: BC002439
• Gene Symbol: TIP30
• Gene ID (NCBI): 10553
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BUP3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TIP30, namely HTATIP2 or CC3, was firstly discovered in small cell lung carcinoma, using differential analyses between highly metastatic human variant cells and less metastatic classic cells.TIP30 was found to be downregulated in various tumors and is considered to be a tumor suppressor due to its pro-apoptotic activity and its anti-metastatic and anti-angiogenic capacities.