TIP30 Recombinant monoclonal antibody, PBS Only (Detector)

TIP30 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 86972-1-PBS
Clone No.252091A12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

HTATIP2, 30 kDa HIV-1 TAT-interacting protein, CC3, EC:1.1.1.-, HIV-1 TAT-interactive protein 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86972-1-PBS targets TIP30 as part of a matched antibody pair:

MP02818-1: 86972-2-PBS capture and 86972-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0353

Product name: Recombinant human TIP30 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 82-276 aa of BC002439

Sequence: TLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP

Predict reactive species
Full Name HIV-1 Tat interactive protein 2, 30kDa
Calculated Molecular Weight 27 kDa
Observed Molecular Weight28 kDa, 32 kDa
GenBank Accession NumberBC002439
Gene Symbol TIP30
Gene ID (NCBI) 10553
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BUP3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TIP30, namely HTATIP2 or CC3, was firstly discovered in small cell lung carcinoma, using differential analyses between highly metastatic human variant cells and less metastatic classic cells.TIP30 was found to be downregulated in various tumors and is considered to be a tumor suppressor due to its pro-apoptotic activity and its anti-metastatic and anti-angiogenic capacities.

Loading...
||
New chat

Able

正在加载,请稍候...