Tested Applications
Positive WB detected in | human testis tissue, mouse brain tissue |
Positive IHC detected in | human spleen tissue, human lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
20117-1-AP targets TMCO6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13992 Product name: Recombinant human TMCO6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 407-493 aa of BC001910 Sequence: NVAEKGPAYCQRLWPGPLLPALLHTLAFSDTEVVGQSLELLHLLFLYQPEAVQVFLQQSGLQALERHQEEAQLQDRVYALQQTALQG Predict reactive species |
Full Name | transmembrane and coiled-coil domains 6 |
Calculated Molecular Weight | 493 aa, 54 kDa |
Observed Molecular Weight | 50-54 kDa |
GenBank Accession Number | BC001910 |
Gene Symbol | TMCO6 |
Gene ID (NCBI) | 55374 |
RRID | AB_10733118 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96DC7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TMCO6 antibody 20117-1-AP | Download protocol |
IHC protocol for TMCO6 antibody 20117-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |