TMEM109 Polyclonal antibody

• 

  WB analysis using 31438-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31438-1-AP (TMEM109 antibody) at dilution of 1:60000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 31438-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31438-1-AP (TMEM109 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse pancreas using 31438-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 31438-1-AP (TMEM109 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 31438-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 31438-1-AP (TMEM109 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 31438-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 31438-1-AP (TMEM109 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse skeletal muscle using 31438-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skeletal muscle tissue using TMEM109 antibody (31438-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse skeletal muscle using 31438-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skeletal muscle tissue using TMEM109 antibody (31438-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TMEM109 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 31438-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

Mg23, Mitsugumin 23, transmembrane protein 109

---

Tested Applications

• Positive WB detected in: mouse heart tissue, HeLa cells, U-251 cells, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue
• Positive IHC detected in: mouse skeletal muscle tissue, mouse pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:100000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31438-1-AP targets TMEM109 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34866

  Product name: Recombinant human TMEM109 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 194-243 aa of BC001309

  Sequence: ILYALLSRLTGSRASGAQLEAKVRGLERQVEELRWRQRRAAKGARSVEEE

• Full Name: transmembrane protein 109
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC001309
• Gene Symbol: TMEM109
• Gene ID (NCBI): 79073
• RRID: AB_3669983
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BVC6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM109, also known as mg23 or mitsugumin-23, is a transmembrane protein localized to the sarcoplasmic/endoplasmic reticulum and nuclear membranes. TMEM109 is a ball-shaped cation channel in the sarcoplasmic reticulum (SR).