Tested Applications
| Positive WB detected in | mouse heart tissue, HeLa cells, U-251 cells, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue |
| Positive IHC detected in | mouse skeletal muscle tissue, mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse skeletal muscle tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31438-1-AP targets TMEM109 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34866 Product name: Recombinant human TMEM109 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 194-243 aa of BC001309 Sequence: ILYALLSRLTGSRASGAQLEAKVRGLERQVEELRWRQRRAAKGARSVEEE Predict reactive species |
| Full Name | transmembrane protein 109 |
| Calculated Molecular Weight | 26 kDa |
| Observed Molecular Weight | 22 kDa |
| GenBank Accession Number | BC001309 |
| Gene Symbol | TMEM109 |
| Gene ID (NCBI) | 79073 |
| RRID | AB_3669983 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9BVC6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM109, also known as mg23 or mitsugumin-23, is a transmembrane protein localized to the sarcoplasmic/endoplasmic reticulum and nuclear membranes. TMEM109 is a ball-shaped cation channel in the sarcoplasmic reticulum (SR).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TMEM109 antibody 31438-1-AP | Download protocol |
| IHC protocol for TMEM109 antibody 31438-1-AP | Download protocol |
| WB protocol for TMEM109 antibody 31438-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













