Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, human heart tissue, pig heart tissue, rat heart tissue, mouse heart tissue, HepG2 cells, Jurkat cells, HSC-T6, NIH/3T3 cells, 4T1 cells |
| Positive IHC detected in | mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 3 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
Product Information
67205-1-Ig targets TMEM111 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18365 Product name: Recombinant human TMEM111 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 139-261 aa of BC022807 Sequence: KVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF Predict reactive species |
| Full Name | transmembrane protein 111 |
| Calculated Molecular Weight | 261 aa, 30 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC022807 |
| Gene Symbol | TMEM111 |
| Gene ID (NCBI) | 55831 |
| RRID | AB_2882498 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9P0I2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM111,also names as EMC3, is part of the endoplasmic reticulum-associated secretory pathway (PMID: 19797678). TMEM111 was required for murine pulmonary surfactant synthesis and lung function at birth (PMID: 29083321). It can be detect a band of 30 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TMEM111 antibody 67205-1-Ig | Download protocol |
| IHC protocol for TMEM111 antibody 67205-1-Ig | Download protocol |
| WB protocol for TMEM111 antibody 67205-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Cell Biol A selectivity filter in the ER membrane protein complex limits protein misinsertion at the ER | ||
bioRxiv Role of a holo-insertase complex in the biogenesis of biophysically diverse ER membrane proteins | ||
bioRxiv The ER membrane protein complex governs lysosomal turnover of a mitochondrial tail-anchored protein, BNIP3, to restrict mitophagy | ||
EMBO J The ER membrane protein complex restricts mitophagy by controlling BNIP3 turnover
|



















