Tested Applications
Positive WB detected in | HEK-293 cells, HeLa cells, human heart tissue, pig heart tissue, rat heart tissue, mouse heart tissue, HepG2 cells, Jurkat cells, HSC-T6, NIH/3T3 cells, 4T1 cells |
Positive IHC detected in | mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 3 publications below |
IF | See 2 publications below |
IP | See 1 publications below |
Product Information
67205-1-Ig targets TMEM111 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
Tested Reactivity | human, mouse, rat, pig |
Cited Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18365 Product name: Recombinant human TMEM111 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 139-261 aa of BC022807 Sequence: KVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF Predict reactive species |
Full Name | transmembrane protein 111 |
Calculated Molecular Weight | 261 aa, 30 kDa |
Observed Molecular Weight | 30 kDa |
GenBank Accession Number | BC022807 |
Gene Symbol | TMEM111 |
Gene ID (NCBI) | 55831 |
RRID | AB_2882498 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q9P0I2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM111,also names as EMC3, is part of the endoplasmic reticulum-associated secretory pathway (PMID: 19797678). TMEM111 was required for murine pulmonary surfactant synthesis and lung function at birth (PMID: 29083321). It can be detect a band of 30 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TMEM111 antibody 67205-1-Ig | Download protocol |
IHC protocol for TMEM111 antibody 67205-1-Ig | Download protocol |
IF protocol for TMEM111 antibody 67205-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Cell Biol A selectivity filter in the ER membrane protein complex limits protein misinsertion at the ER | ||
bioRxiv Role of a holo-insertase complex in the biogenesis of biophysically diverse ER membrane proteins | ||
EMBO J The ER membrane protein complex restricts mitophagy by controlling BNIP3 turnover
| ||
bioRxiv The ER membrane protein complex governs lysosomal turnover of a mitochondrial tail-anchored protein, BNIP3, to restrict mitophagy |