TMEM111 Monoclonal antibody

• 

  WB analysis using 67205-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67205-1-Ig (TMEM111 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 67205-1-Ig

  WB result of TMEM111 antibody (67205-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TMEM111 transfected HEK-293 cells.

• 

  WB analysis using 67205-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67205-1-Ig (TMEM111 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 67205-1-Ig

  human heart tissue were subjected to SDS PAGE followed by western blot with 67205-1-Ig (TMEM111 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig heart using 67205-1-Ig

  pig heart tissue were subjected to SDS PAGE followed by western blot with 67205-1-Ig (TMEM111 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat heart using 67205-1-Ig

  rat heart tissue were subjected to SDS PAGE followed by western blot with 67205-1-Ig (TMEM111 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 67205-1-Ig

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 67205-1-Ig (TMEM111 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse lung using 67205-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 67205-1-Ig (TMEM111 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 67205-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 67205-1-Ig (TMEM111 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 67205-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using TMEM111 antibody (67205-1-Ig, Clone: 2F8G5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1).

• Featured Product
• KD/KO Validated

TMEM111 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67205-1-Ig

Clone No.2F8G5

Publications(6)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

EMC3, 2F8G5, POB

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, human heart tissue, pig heart tissue, rat heart tissue, mouse heart tissue, HepG2 cells, Jurkat cells, HSC-T6, NIH/3T3 cells, 4T1 cells
• Positive IHC detected in: mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

67205-1-Ig targets TMEM111 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18365

  Product name: Recombinant human TMEM111 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 139-261 aa of BC022807

  Sequence: KVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF

• Full Name: transmembrane protein 111
• Calculated Molecular Weight: 261 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC022807
• Gene Symbol: TMEM111
• Gene ID (NCBI): 55831
• RRID: AB_2882498
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9P0I2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM111,also names as EMC3, is part of the endoplasmic reticulum-associated secretory pathway (PMID: 19797678). TMEM111 was required for murine pulmonary surfactant synthesis and lung function at birth (PMID: 29083321). It can be detect a band of 30 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IP	Mol Cell; WNK1 is an assembly factor for the human ER membrane protein complex.; Authors - Tino Pleiner
human	WB	J Cell Biol; A selectivity filter in the ER membrane protein complex limits protein misinsertion at the ER; Authors - Tino Pleiner
human	WB	bioRxiv; Role of a holo-insertase complex in the biogenesis of biophysically diverse ER membrane proteins; Authors - Katharine R Page
human	IF	EMBO J; The ER membrane protein complex restricts mitophagy by controlling BNIP3 turnover; Authors - Jose M Delgado ; KO Validated
human	WB	Science; MTCH2 is a mitochondrial outer membrane protein insertase; Authors - Alina Guna
human	IF	bioRxiv; The ER membrane protein complex governs lysosomal turnover of a mitochondrial tail-anchored protein, BNIP3, to restrict mitophagy; Authors - Jose M Delgado