Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, human heart tissue, pig heart tissue, rat heart tissue, mouse heart tissue, HepG2 cells, Jurkat cells, HSC-T6, NIH/3T3 cells, 4T1 cells |
| Positive IHC detected in | mouse lung tissue, human placenta tissue, mouse kidney tissue, human pancreas cancer tissue, rat kidney tissue, rat pancreas tissue, mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67205-1-Ig targets TMEM111 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18365 Product name: Recombinant human TMEM111 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 139-261 aa of BC022807 Sequence: KVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF Predict reactive species |
| Full Name | transmembrane protein 111 |
| Calculated Molecular Weight | 261 aa, 30 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC022807 |
| Gene Symbol | TMEM111 |
| Gene ID (NCBI) | 55831 |
| RRID | AB_2882498 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9P0I2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM111,also names as EMC3, is part of the endoplasmic reticulum-associated secretory pathway (PMID: 19797678). TMEM111 was required for murine pulmonary surfactant synthesis and lung function at birth (PMID: 29083321). It can be detect a band of 30 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TMEM111 antibody 67205-1-Ig | Download protocol |
| IHC protocol for TMEM111 antibody 67205-1-Ig | Download protocol |
| WB protocol for TMEM111 antibody 67205-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TMEM111 Monoclonal antibody (2F8G5) (Cat# 67205-1-Ig) has 9 citations published in Science, Nature Communications, Molecular Cell, EMBO Journal, Journal of Cell Biology, and bioRxiv. Research fields include ER membrane protein complex (EMC) biogenesis, mitochondrial outer membrane protein insertase activity, mitophagy regulation via BNIP3 turnover, protein misinsertion at the ER, and VDAC-mediated calcium homeostasis in cancer cells.
| Species | Application | Title |
|---|---|---|
Nat Commun A small molecule VDAC ligand inhibits ERAD and induces selective cancer cell death via disruption of calcium homeostasis. | ||
Mol Cell Role of a holo-insertase complex in the biogenesis of biophysically diverse ER membrane proteins.
| ||
EMBO J The ER membrane protein complex restricts mitophagy by controlling BNIP3 turnover
| ||
J Cell Biol A selectivity filter in the ER membrane protein complex limits protein misinsertion at the ER |
