TMEM111 Monoclonal antibody, PBS Only

• 

  WB analysis using 67205-1-Ig (same clone as 67205-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67205-1-Ig (TMEM111 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67205-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67205-1-Ig (same clone as 67205-1-PBS)

  WB result of TMEM111 antibody (67205-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TMEM111 transfected HEK-293 cells. This data was developed using the same antibody clone with 67205-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67205-1-Ig (same clone as 67205-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67205-1-Ig (TMEM111 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67205-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 67205-1-Ig (same clone as 67205-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 67205-1-Ig (TMEM111 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67205-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig heart using 67205-1-Ig (same clone as 67205-1-PBS)

  pig heart tissue were subjected to SDS PAGE followed by western blot with 67205-1-Ig (TMEM111 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67205-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat heart using 67205-1-Ig (same clone as 67205-1-PBS)

  rat heart tissue were subjected to SDS PAGE followed by western blot with 67205-1-Ig (TMEM111 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67205-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 67205-1-Ig (same clone as 67205-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 67205-1-Ig (TMEM111 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67205-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 67205-1-Ig (same clone as 67205-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 67205-1-Ig (TMEM111 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67205-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 67205-1-Ig (same clone as 67205-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 67205-1-Ig (TMEM111 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67205-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 67205-1-Ig (same clone as 67205-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using TMEM111 antibody (67205-1-Ig, Clone: 2F8G5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67205-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TMEM111 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67205-1-PBS

Clone No.2F8G5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

EMC3, 2F8G5, POB

---

Product Information

67205-1-PBS targets TMEM111 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18365

  Product name: Recombinant human TMEM111 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 139-261 aa of BC022807

  Sequence: KVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF

• Full Name: transmembrane protein 111
• Calculated Molecular Weight: 261 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC022807
• Gene Symbol: TMEM111
• Gene ID (NCBI): 55831
• RRID: AB_2882498
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9P0I2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM111,also names as EMC3, is part of the endoplasmic reticulum-associated secretory pathway (PMID: 19797678). TMEM111 was required for murine pulmonary surfactant synthesis and lung function at birth (PMID: 29083321). It can be detect a band of 30 kDa.