Tested Applications
| Positive WB detected in | rabbit brain tissue, rat brain tissue, mouse brain tissue, pig cerebellum tissue, pig brain tissue, rat cerebellum tissue, mouse cerebellum tissue, Rabbit cerebellum tissue, Chicken brain tissue |
This antibody is not recommended for IHC/IF test.
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66948-1-Ig targets TMEM119 in WB, ELISA applications and shows reactivity with Human, Pig, Mouse, Rat, rabbit samples.
| Tested Reactivity | Human, Pig, Mouse, Rat, rabbit |
| Cited Reactivity | human, mouse, rat, canine |
| Host / Isotype | Mouse / IgG3 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26286 Product name: Recombinant human TMEM119 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 119-218 aa of NM_181724 Sequence: MRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQE Predict reactive species |
| Full Name | transmembrane protein 119 |
| Calculated Molecular Weight | 29 kDa |
| Observed Molecular Weight | 52 kDa |
| GenBank Accession Number | NM_181724 |
| Gene Symbol | TMEM119 |
| Gene ID (NCBI) | 338773 |
| RRID | AB_2882272 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q4V9L6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). Microglia can be detected clearly using Catalog#66948-1-Ig. The predicted MW of TMEM119 is 29 kDa. Catalog#66948-1-Ig recognizes 50 kDa band may due to glycosylation.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TMEM119 antibody 66948-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-TMEM119 antibody (Cat# 66948-1-Ig) has accumulated 40 citations across high-impact journals including Cancer Cell, ACS Nano, J Extracell Vesicles, Autophagy, J Neuroinflammation, Cell Rep, Free Radic Biol Med, and Brain Behav Immun. Research fields covered include neuroinflammation, ischemic stroke, Alzheimer's disease, spinal cord injury, glioblastoma, neuropathic pain, microglial biology, extracellular vesicle research, and neurodegenerative disorders.
| Species | Application | Title |
|---|---|---|
Cancer Cell Overcoming tyrosine kinase inhibitor resistance in lung cancer brain metastasis with CTLA4 blockade | ||
Exploration (Beijing) Microglial targeted therapy relieves cognitive impairment caused by Cntnap4 deficiency | ||
J Extracell Vesicles Characterization of brain-derived extracellular vesicles reveals changes in cellular origin after stroke and enrichment of the prion protein with a potential role in cellular uptake. | ||
J Extracell Vesicles Microglial Extracellular Vesicles Mediate C1q Deposition at the Pre-Synapse and Promote Synaptic Pruning. | ||
ACS Nano Targeted Microglial Membrane-Coated MicroRNA Nanosponge Mediates Inhibition of Glioblastoma |
Reviews
What customers say
User reviews for this antibody are mixed. One reviewer (3/5) reported it works for IHC on rat brain tissue at 1:500 with antigen retrieval and normal goat serum blocking, noting that while images were not perfect, the antibody did show expression. Another reviewer (1/5) found it ineffective for IHC-p on both human and murine brain tissue across a tested range of 1:250–1:1000. Overall, results appear to vary by tissue source and protocol optimization, with success dependent on proper antigen retrieval and blocking conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Amirah (Verified Customer) (03-02-2023) | The antibody works using the antigen retrieval method beforehand and using normal goat serum as a blocking buffer. Images not perfect but it still allows the antibody to be expressed.
|
Hannes (Verified Customer) (03-08-2021) | The antibody did not work in IHC-p on human and murine brain tissue.
 |
