Tested Applications
| Positive WB detected in | rabbit brain tissue, rat brain tissue, mouse brain tissue, pig cerebellum tissue, pig brain tissue, rat cerebellum tissue, mouse cerebellum tissue, Rabbit cerebellum tissue, Chicken brain tissue |
This antibody is not recommended for IHC/IF test.
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 17 publications below |
| FC | See 1 publications below |
Product Information
66948-1-Ig targets TMEM119 in WB, ELISA applications and shows reactivity with Human, Pig, Mouse, Rat, rabbit samples.
| Tested Reactivity | Human, Pig, Mouse, Rat, rabbit |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG3 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26286 Product name: Recombinant human TMEM119 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 119-218 aa of NM_181724 Sequence: MRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQE Predict reactive species |
| Full Name | transmembrane protein 119 |
| Calculated Molecular Weight | 29 kDa |
| Observed Molecular Weight | 52 kDa |
| GenBank Accession Number | NM_181724 |
| Gene Symbol | TMEM119 |
| Gene ID (NCBI) | 338773 |
| RRID | AB_2882272 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q4V9L6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). Microglia can be detected clearly using Catalog#66948-1-Ig. The predicted MW of TMEM119 is 29 kDa. Catalog#66948-1-Ig recognizes 50 kDa band may due to glycosylation.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TMEM119 antibody 66948-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
ACS Nano Neutrophil Nanovesicle Protects against Experimental Autoimmune Encephalomyelitis through Enhancing Myelin Clearance by Microglia | ||
J Extracell Vesicles Characterization of brain-derived extracellular vesicles reveals changes in cellular origin after stroke and enrichment of the prion protein with a potential role in cellular uptake. | ||
Int J Biol Sci Defective neurite elongation and branching in Nibp/Trappc9 deficient zebrafish and mice | ||
Acta Pharmacol Sin Prebiotic diet normalizes aberrant immune and behavioral phenotypes in a mouse model of autism spectrum disorder | ||
Oxid Med Cell Longev Methane-Rich Saline Alleviates CA/CPR Brain Injury by Inhibiting Oxidative Stress, Microglial Activation-Induced Inflammatory Responses, and ER Stress-Mediated Apoptosis. | ||
Antioxidants (Basel) TNF-α Levels Are Increased in Patients with Subjective Cognitive Impairment and Are Negatively Correlated with β Amyloid-42 |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Amirah (Verified Customer) (03-02-2023) | The antibody works using the antigen retrieval method beforehand and using normal goat serum as a blocking buffer. Images not perfect but it still allows the antibody to be expressed.
|
FH Hannes (Verified Customer) (03-08-2021) | The antibody did not work in IHC-p on human and murine brain tissue.
![]() |


