TMEM119 Monoclonal antibody, PBS Only

• 

  WB analysis using 66948-1-Ig (same clone as 66948-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66948-1-Ig (TMEM119 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66948-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TMEM119 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66948-1-PBS

Clone No.1E7A2

Host / Isotype

Mouse / IgG3

Reactivity

Human, Pig, Mouse, Rat, rabbit

Applications

WB, Indirect ELISA

Synonyms

TMEM119, transmembrane protein 119, UNQ731/PRO1415

---

This antibody is not recommended for IHC/IF test.

Product Information

66948-1-PBS targets TMEM119 in WB, Indirect ELISA applications and shows reactivity with Human, Pig, Mouse, Rat, rabbit samples.

• Tested Reactivity: Human, Pig, Mouse, Rat, rabbit
• Host / Isotype: Mouse / IgG3
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26286

  Product name: Recombinant human TMEM119 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 119-218 aa of NM_181724

  Sequence: MRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQE

• Full Name: transmembrane protein 119
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: NM_181724
• Gene Symbol: TMEM119
• Gene ID (NCBI): 338773
• RRID: AB_2882272
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q4V9L6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). Microglia can be detected clearly using Catalog#66948-1-Ig. The predicted MW of TMEM119 is 29 kDa. Catalog#66948-1-Ig recognizes 50 kDa band may due to glycosylation.