TMEM119 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TMEM119 Recombinant monoclonal antibody, PBS Only (83448-6-PBS)

• 

  WB analysis using 83448-6-RR (same clone as 83448-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83448-6-RR (TMEM119 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83448-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83448-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83448-6-RR against Human TMEM119 were performed. The affinity constant is 9.33 nM.

TMEM119 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 83448-6-PBS

Clone No.240433F2

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Indirect ELISA

Synonyms

240433F2, OBIF, Osteoblast induction factor, transmembrane protein 119, UNQ731/PRO1415

---

Product Information

83448-6-PBS targets TMEM119 in WB, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0796

  Product name: Recombinant Human TMEM119 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 118-283 aa of NM_181724.2

  Sequence: TRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPSV

• Full Name: transmembrane protein 119
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: NM_181724.2
• Gene Symbol: TMEM119
• Gene ID (NCBI): 338773
• RRID: AB_3671086
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q4V9L6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). Microglia can be detected clearly using Catalog#83448-6-RR. The predicted MW of TMEM119 is 29 kDa. Catalog#66948-1-Ig recognizes 50 kDa band may due to glycosylation.