Anti-Human TMEM119 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human TMEM119 Rabbit Recombinant Antibody (98677-3-RR)

• 

  FC experiment of Transfected CHO-K1 using 98677-3-RR

  1x10^6 CHO-K1(left) or TMEM119-transfected CHO-K1(right) were surface stained with 0.25 ug Anti-Human TMEM119 Rabbit RecAb (98677-3-RR, Clone:251557E2) and PE-conjugated Goat Anti-Rabbit IgG. Cells were not fixed.

• 

  FC experiment of SH-SY5Y using 98677-3-RR

  1x10^6 SH-SY5Y cells were stained with 0.25 ug Anti-Human TMEM119 Rabbit RecAb (98677-3-RR, Clone:251557E2) (red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue) and PE-conjugated Goat Anti-Rabbit IgG. Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• 

  FC experiment of Transfected CHO-K1 using 98677-3-RR

  1x10^6 CHO-K1(left) or TMEM119-transfected CHO-K1(right) were surface stained with 0.25 ug Anti-Human TMEM119 Rabbit RecAb (98677-3-RR, Clone:251557E2) (red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue) and PE-conjugated Goat Anti-Rabbit IgG. Cells were not fixed.

• 

  Affinity of 98677-3-RR

  Biolayer interferometry (BLl) kinetic assays of 98677-3-RR against Human TMEM119 were performed. The affinity constant is 6.55 nM.

TMEM119 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98677-3-RR

Clone No.251557E2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

OBIF, Osteoblast induction factor, transmembrane protein 119, UNQ731/PRO1415

---

Tested Applications

• Positive FC detected in: SH-SY5Y cells, Transfected CHO-K1

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98677-3-RR targets TMEM119 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1823

  Product name: Recombinant human TMEM119 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 26-96 aa of NM_181724

  Sequence: RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVM

• Full Name: transmembrane protein 119
• Calculated Molecular Weight: 29 kDa
• GenBank Accession Number: NM_181724
• Gene Symbol: TMEM119
• Gene ID (NCBI): 338773
• RRID: AB_3746265
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q4V9L6
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

TMEM119 (Transmembrane Protein 119), also known as OBIF (Osteoblast Induction Factor), is a type I transmembrane protein that serves as a highly specific marker for resident microglia in the central nervous system (CNS). TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788).