TMEM175 Recombinant monoclonal antibody

• 

  WB analysis of HepG2 using 84554-1-RR

  WB result of TMEM175 antibody (84554-1-RR; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TMEM175 transfected HepG2 cells.

• 

  WB analysis using 84554-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84554-1-RR (TMEM175 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 84554-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84554-1-RR against Human TMEM175 were performed. The affinity constant is 5.17 nM.

• Featured Product
• KD/KO Validated

TMEM175 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 84554-1-RR

Clone No.241567B9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

241567B9, hTMEM175, Transmembrane protein 175

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, LNCaP cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84554-1-RR targets TMEM175 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13890

  Product name: Recombinant human TMEM175 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 222-313 aa of BC005158

  Sequence: YVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAY

• Full Name: transmembrane protein 175
• Calculated Molecular Weight: 504 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC005158
• Gene Symbol: TMEM175
• Gene ID (NCBI): 84286
• RRID: AB_3672062
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9BSA9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM175 has two repeats of 6-transmembrane-spanning segments and has no GYG K+ channel sequence signature-containing, pore-forming P loop. Lysosomes lacking TMEM175 exhibit no K+conductance, have a markedly depolarized ΔΨ and little sensitivity to changes in [K+], and have compromised luminal pH stability and abnormal fusion with autophagosomes during autophagy. TMEM175 comprises a K+ channel that underlies the molecular mechanism of lysosomal K+ permeability. It has two isoforms with MW 41-45 kDa and 54-60 kDa. For optimal WB detection with this antibody, we recommend avoiding boiling the sample after lysis.