TMEM38A Polyclonal antibody, PBS Only

• 

  WB analysis of mouse skeletal muscle using 19920-1-AP (same clone as 19920-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 19920-1-AP (TMEM38A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19920-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 19920-1-AP (same clone as 19920-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 19920-1-AP (TMEM38A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19920-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 19920-1-AP (same clone as 19920-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 19920-1-AP (TMEM38A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19920-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 19920-1-AP (same clone as 19920-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 19920-1-AP (TMEM38A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19920-1-PBS in a different storage buffer formulation.

TMEM38A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 19920-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

19920-1-PBS targets TMEM38A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13846

  Product name: Recombinant human TMEM38A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 210-299 aa of BC001195

  Sequence: ASLIFIFTLFMVSCKVFLTATHSHSSPFDALEGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMPAKSKEELSEGSRKKKAKKAD

• Full Name: transmembrane protein 38A
• Calculated Molecular Weight: 299 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC001195
• Gene Symbol: TMEM38A
• Gene ID (NCBI): 79041
• RRID: AB_10638779
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6F2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.