TMEM38A Polyclonal antibody

• 

  WB analysis of mouse skeletal muscle using 19920-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 19920-1-AP (TMEM38A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 19920-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 19920-1-AP (TMEM38A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 19920-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 19920-1-AP (TMEM38A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 19920-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 19920-1-AP (TMEM38A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TMEM38A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 19920-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

Synonyms

TMEM38A, transmembrane protein 38A, TRICA, TRIC-A

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, HeLa cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

19920-1-AP targets TMEM38A in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13846

  Product name: Recombinant human TMEM38A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 210-299 aa of BC001195

  Sequence: ASLIFIFTLFMVSCKVFLTATHSHSSPFDALEGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMPAKSKEELSEGSRKKKAKKAD

• Full Name: transmembrane protein 38A
• Calculated Molecular Weight: 299 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC001195
• Gene Symbol: TMEM38A
• Gene ID (NCBI): 79041
• RRID: AB_10638779
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6F2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Circ Res; TRIC-A Channel Maintains Store Calcium Handling by Interacting with Type 2 Ryanodine Receptor in Cardiac Muscle.; Authors - Xinyu Zhou