CoraLite® Plus 488-conjugated TMEM53 Recombinant monoclonal antibody

TMEM53 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-83554-3
Clone No.240511C3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Transmembrane protein 53, Nuclear envelope transmembrane protein 4, NET4, 240511C3

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA549 cells
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83554-3 targets TMEM53 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag21321

Product name: Recombinant human TMEM53 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 198-277 aa of BC064520

Sequence: HFYDRLQDAGSRWPELYLYSRADEVVLARDIERMVEARLARRVLARSVDFVSSAHVSHLRDYPTYYTSLCVDFMRNCVRC

Predict reactive species
Full Name transmembrane protein 53
Calculated Molecular Weight 277 aa, 32 kDa
GenBank Accession NumberBC064520
Gene Symbol TMEM53
Gene ID (NCBI) 79639
RRIDAB_3673272
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6P2H8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TMEM53 was initially described as a nuclear envelope transmembrane (NET) protein because of its nuclear envelope localization. Research has found that TMEM53 functionality does not rely on viral RNA binding or canonical IFN responses, and TMEM53 exerts an antiviral effect on other bat HKU2-related CoVs in a species-specific manner. Therefore, TMEM53 may be a potential therapeutic target for HKU2-related CoV infections and useful for preparing for future outbreaks of this viral species. (PMID: 37584551)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TMEM53 antibody CL488-83554-3Download protocol
FC protocol for CL Plus 488 TMEM53 antibody CL488-83554-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...