Tested Applications
Positive IF/ICC detected in | A549 cells |
Positive FC (Intra) detected in | A549 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-83554-3 targets TMEM53 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag21321 Product name: Recombinant human TMEM53 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 198-277 aa of BC064520 Sequence: HFYDRLQDAGSRWPELYLYSRADEVVLARDIERMVEARLARRVLARSVDFVSSAHVSHLRDYPTYYTSLCVDFMRNCVRC Predict reactive species |
Full Name | transmembrane protein 53 |
Calculated Molecular Weight | 277 aa, 32 kDa |
GenBank Accession Number | BC064520 |
Gene Symbol | TMEM53 |
Gene ID (NCBI) | 79639 |
RRID | AB_3673272 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q6P2H8 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
TMEM53 was initially described as a nuclear envelope transmembrane (NET) protein because of its nuclear envelope localization. Research has found that TMEM53 functionality does not rely on viral RNA binding or canonical IFN responses, and TMEM53 exerts an antiviral effect on other bat HKU2-related CoVs in a species-specific manner. Therefore, TMEM53 may be a potential therapeutic target for HKU2-related CoV infections and useful for preparing for future outbreaks of this viral species. (PMID: 37584551)
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 TMEM53 antibody CL488-83554-3 | Download protocol |
FC protocol for CL Plus 488 TMEM53 antibody CL488-83554-3 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |