TMEM70 Monoclonal antibody

• 

  WB analysis of A2780 using 60195-1-Ig

  A2780 cells were subjected to SDS PAGE followed by western blot with 60195-1-Ig (TMEM70 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 60195-1-Ig

  WB result of TMEM70 antibody (60195-1-Ig; 1:1500; incubated at room temperature for 1.5 hours) with sh-Control and sh-TMEM70 transfected HeLa cells.

• 

  IHC staining of human liver using 60195-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver using 60195-1-Ig(TMEM70 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver using 60195-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver using 60195-1-Ig(TMEM70 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human pancreas using 60195-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas using 60195-1-Ig(TMEM70 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human pancreas using 60195-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas using 60195-1-Ig(TMEM70 antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

TMEM70 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60195-1-Ig

Clone No.2C11C3

Publications(1)

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

TMEM70, transmembrane protein 70

---

Tested Applications

• Positive WB detected in: A2780 cells, HeLa cells
• Positive IHC detected in: human liver tissue, human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

60195-1-Ig targets TMEM70 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16947

  Product name: Recombinant human TMEM70 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 148-260 aa of BC002748

  Sequence: MGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK

• Full Name: transmembrane protein 70
• Calculated Molecular Weight: 260 aa, 29 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC002748
• Gene Symbol: TMEM70
• Gene ID (NCBI): 54968
• RRID: AB_10896316
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BUB7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM70 belongs to the TMEM70 family. It is involved in biogenesis of mitochondrial ATP synthase. Defects in TMEM70 are a cause of mitochondrial encephalocardiomyopathy neonatal due to ATP synthase deficiency (MT-ATPSD). A publication (PMID:21147908) identified TMEM70 gene defect as a pan-ethnic disorder and further redefined it as the most common cause of nuclear-origin ATP synthase deficiency.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mitochondrion; Mitochondrial membrane assembly of TMEM70 protein.; Authors - Hana Kratochvílová