TMEM70 Monoclonal antibody, PBS Only

• 

  WB analysis of A2780 using 60195-1-Ig (same clone as 60195-1-PBS)

  A2780 cells were subjected to SDS PAGE followed by western blot with 60195-1-Ig (TMEM70 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60195-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 60195-1-Ig (same clone as 60195-1-PBS)

  WB result of TMEM70 antibody (60195-1-Ig; 1:1500; incubated at room temperature for 1.5 hours) with sh-Control and sh-TMEM70 transfected HeLa cells. This data was developed using the same antibody clone with 60195-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 60195-1-Ig (same clone as 60195-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 60195-1-Ig(TMEM70 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60195-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 60195-1-Ig (same clone as 60195-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 60195-1-Ig(TMEM70 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60195-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 60195-1-Ig (same clone as 60195-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas using 60195-1-Ig(TMEM70 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60195-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 60195-1-Ig (same clone as 60195-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas using 60195-1-Ig(TMEM70 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60195-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TMEM70 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 60195-1-PBS

Clone No.2C11C3

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

TMEM70, transmembrane protein 70

---

Product Information

60195-1-PBS targets TMEM70 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16947

  Product name: Recombinant human TMEM70 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 148-260 aa of BC002748

  Sequence: MGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK

• Full Name: transmembrane protein 70
• Calculated Molecular Weight: 260 aa, 29 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC002748
• Gene Symbol: TMEM70
• Gene ID (NCBI): 54968
• RRID: AB_10896316
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BUB7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM70 belongs to the TMEM70 family. It is involved in biogenesis of mitochondrial ATP synthase. Defects in TMEM70 are a cause of mitochondrial encephalocardiomyopathy neonatal due to ATP synthase deficiency (MT-ATPSD). A publication (PMID:21147908) identified TMEM70 gene defect as a pan-ethnic disorder and further redefined it as the most common cause of nuclear-origin ATP synthase deficiency.