Product Information
60195-1-PBS targets TMEM70 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16947 Product name: Recombinant human TMEM70 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 148-260 aa of BC002748 Sequence: MGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK Predict reactive species |
Full Name | transmembrane protein 70 |
Calculated Molecular Weight | 260 aa, 29 kDa |
Observed Molecular Weight | 18 kDa |
GenBank Accession Number | BC002748 |
Gene Symbol | TMEM70 |
Gene ID (NCBI) | 54968 |
RRID | AB_10896316 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9BUB7 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
TMEM70 belongs to the TMEM70 family. It is involved in biogenesis of mitochondrial ATP synthase. Defects in TMEM70 are a cause of mitochondrial encephalocardiomyopathy neonatal due to ATP synthase deficiency (MT-ATPSD). A publication (PMID:21147908) identified TMEM70 gene defect as a pan-ethnic disorder and further redefined it as the most common cause of nuclear-origin ATP synthase deficiency.