Filter: AllWBIHC

WB analysis using 25091-1-AP
RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 25091-1-AP (TMEM87A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
WB analysis of MDA-MB-453s using 25091-1-AP
MDA-MB-453s cells were subjected to SDS PAGE followed by western blot with 25091-1-AP (TMEM87A Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
WB analysis of PC-3 using 25091-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 25091-1-AP (TMEM87A Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
IHC staining of human breast cancer using 25091-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25091-1-AP (TMEM87A Antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human breast cancer using 25091-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25091-1-AP (TMEM87A Antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human prostate cancer using 25091-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25091-1-AP (TMEM87A Antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human prostate cancer using 25091-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25091-1-AP (TMEM87A Antibody) at dilution of 1:50 (under 40x lens).

TMEM87A Polyclonal antibody

Name: TMEM87A Polyclonal antibody
Brand: Proteintech
SKU: 25091-1-AP
Rating: 1.00 (1 reviews)

TMEM87A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25091-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Elkin1, PSEC0094, TM87A, Transmembrane protein 87A

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	RAW 264.7 cells, MDA-MB-453s cells, PC-3 cells
Positive IHC detected in	human breast cancer tissue, human prostate cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:200-1:1000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25091-1-AP targets TMEM87A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag18715 Product name: Recombinant human TMEM87A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 71-160 aa of BC005335 Sequence: GEPCDLSLNITWYLKSADCYNEIYNFKAEEVELYLEKLKEKRGLSGKYQTSSKLFQNCSELFKTQTFSGDFMHRLPLLGEKQEAKENGTN Predict reactive species
Full Name	transmembrane protein 87A
Calculated Molecular Weight	555 aa, 63 kDa
Observed Molecular Weight	63-70 kDa
GenBank Accession Number	BC005335
Gene Symbol	TMEM87A
Gene ID (NCBI)	25963
RRID	AB_2879892
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8NBN3
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transmembrane protein 87A (TMEM87A) represents an evolutionarily conserved transmembrane protein. It is predominantly localized to the Golgi complex and involved in retrograde intracellular trafficking (PMID: 26157166). Moreover, TMEM87A has been identified to localize at the plasma membrane of melanoma cells and facilitate mechanoelectrical transduction. Furthermore, it is functionally characterized as an ion channel expressed in sensory neurons, which is responsible for mediating light touch sensory transduction (PMID: 32228863; 38422143).

Protocols

Product Specific Protocols
IHC protocol for TMEM87A antibody 25091-1-AP	Download protocol
WB protocol for TMEM87A antibody 25091-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Reviews

Add a review

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

Boyan (Verified Customer) (12-16-2021)

This antibody recognized a band around 60 kd, however, this band is not sensitive to deglycosylation. What's worse, this band also occurred in solo loading buffer.