TMEM87A Polyclonal antibody

• 

  WB analysis using 25091-1-AP

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 25091-1-AP (TMEM87A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MDA-MB-453s using 25091-1-AP

  MDA-MB-453s cells were subjected to SDS PAGE followed by western blot with 25091-1-AP (TMEM87A Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 25091-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25091-1-AP (TMEM87A Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 25091-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25091-1-AP (TMEM87A Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 25091-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25091-1-AP (TMEM87A Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human prostate cancer using 25091-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25091-1-AP (TMEM87A Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human prostate cancer using 25091-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25091-1-AP (TMEM87A Antibody) at dilution of 1:50 (under 40x lens).

TMEM87A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25091-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Transmembrane protein 87A, TM87A, PSEC0094, Elkin1

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells, MDA-MB-453s cells, PC-3 cells
• Positive IHC detected in: human breast cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25091-1-AP targets TMEM87A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18715

  Product name: Recombinant human TMEM87A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 71-160 aa of BC005335

  Sequence: GEPCDLSLNITWYLKSADCYNEIYNFKAEEVELYLEKLKEKRGLSGKYQTSSKLFQNCSELFKTQTFSGDFMHRLPLLGEKQEAKENGTN

• Full Name: transmembrane protein 87A
• Calculated Molecular Weight: 555 aa, 63 kDa
• Observed Molecular Weight: 63-70 kDa
• GenBank Accession Number: BC005335
• Gene Symbol: TMEM87A
• Gene ID (NCBI): 25963
• RRID: AB_2879892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NBN3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Boyan (Verified Customer) (12-16-2021)

This antibody recognized a band around 60 kd, however, this band is not sensitive to deglycosylation. What's worse, this band also occurred in solo loading buffer.

• Applications: Western Blot