Tested Applications
Positive WB detected in | RAW 264.7 cells, MDA-MB-453s cells, PC-3 cells |
Positive IHC detected in | human breast cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25091-1-AP targets TMEM87A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18715 Product name: Recombinant human TMEM87A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 71-160 aa of BC005335 Sequence: GEPCDLSLNITWYLKSADCYNEIYNFKAEEVELYLEKLKEKRGLSGKYQTSSKLFQNCSELFKTQTFSGDFMHRLPLLGEKQEAKENGTN Predict reactive species |
Full Name | transmembrane protein 87A |
Calculated Molecular Weight | 555 aa, 63 kDa |
Observed Molecular Weight | 63-70 kDa |
GenBank Accession Number | BC005335 |
Gene Symbol | TMEM87A |
Gene ID (NCBI) | 25963 |
RRID | AB_2879892 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8NBN3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TMEM87A antibody 25091-1-AP | Download protocol |
IHC protocol for TMEM87A antibody 25091-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Boyan (Verified Customer) (12-16-2021) | This antibody recognized a band around 60 kd, however, this band is not sensitive to deglycosylation. What's worse, this band also occurred in solo loading buffer.
|