CoraLite® Plus 488-conjugated TNC/Tenascin-C Monoclonal antibody

• 

  IF Staining of mouse brain using CL488-67710

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite® Plus 488 TNC/Tenascin-C antibody (CL488-67710, Clone: 1F7G8 ) at dilution of 1:200.

TNC/Tenascin-C Monoclonal Antibody for IF-P

Cat No. CL488-67710

Clone No.1F7G8

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

IF-P

Synonyms

Cytotactin, GMEM, GP 150 225, Hexabrachion, HXB, JI, Myotendinous antigen, Neuronectin, Tenascin, tenascin C, TN, TN C, TNC

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67710 targets TNC/Tenascin-C in IF-P applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21412

  Product name: Recombinant human TNC protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1852-2201 aa of BC151843

  Sequence: YALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA

• Full Name: tenascin C
• Calculated Molecular Weight: 2201 aa, 241 kDa
• Observed Molecular Weight: 260 kDa
• GenBank Accession Number: BC151843
• Gene Symbol: Tenascin C
• Gene ID (NCBI): 3371
• RRID: AB_2934562
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P24821
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Tenascin-C (TNC) is a large hexameric extracellular matrix glycoprotein of the tenascin family (PMID: 21818551). It is a multimodular protein containing multiple epidermal growth factor (EGF)-like repeats and fibronectin type III (FN III) domains (PMID: 1719530). Tenascin-C is highly expressed during embryonic development, particularly in the developing central nervous system, around motile cells and at epithelial-mesenchymal interaction sites (PMID: 25738825). In adult tissues, the expression and the distribution of TNC are typically limited under normal physiological conditions. It is upregulated during injury, inflammation, regeneration, and cancer (PMID: 7694605; 25120494). Tenascin-C is a diverse protein that can produce different functions including regulating cell adhesion, migration and proliferation.