Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, mouse kidney tissue, rat kidney tissue, SH-SY5Y cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse brain tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HUVEC cells, HepG2 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 461 publications below |
| IHC | See 25 publications below |
| IF | See 404 publications below |
| IP | See 4 publications below |
| CoIP | See 1 publications below |
Product Information
11802-1-AP targets TOM20 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, chicken samples.
| Tested Reactivity | human, mouse, rat, chicken |
| Cited Reactivity | human, mouse, rat, pig, rabbit, monkey, chicken, zebrafish, hamster, cattle |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2378 Product name: Recombinant human TOM20 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC000882 Sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE Predict reactive species |
| Full Name | translocase of outer mitochondrial membrane 20 homolog (yeast) |
| Calculated Molecular Weight | 145 aa, 16 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | BC000882 |
| Gene Symbol | TOM20 |
| Gene ID (NCBI) | 9804 |
| RRID | AB_2207530 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15388 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Background
TOM20 (KIAA0016) belongs to the Tom family. It is a subunit of the mitochondrial import receptor (PMID: 7584026), whose main role is to translocate cytosolically synthesized mitochondrial proteins through the outer mitochondrial membrane and subsequently facilitate the movement of proteins into the TOM40 translocation pore complex (PMID: 21173275).
What is the molecular weight of TOM20?
It is a short 16.3 kDa protein containing several highly conserved regions, including the transmembrane segment, the ligand-binding domain, and flexible segments at the N terminus and the C terminus of the protein crucial for its function (PMID: 15733919).
What is the subcellular localization of TOM20?
It specifically localizes in the mitochondrial outer membrane. In malignant cells, strong granular staining in the cytoplasm has been observed.
What is the tissue specificity of TOM20?
It is ubiquitously expressed in various tissues, with a particularly high expression in the brain, thyroid, and pancreas.
What is the function of TOM20 in the mitochondrial membrane?
Mitochondrial preproteins are generally synthesized in the cytoplasm with signal or targeting sequences, which are recognized by specific receptors on the outer mitochondrial membrane. TOM20, as one of the components of the TOM40 complex, specifically recognizes pre-sequences on target proteins or their unfolded forms. In addition to its translocase activity, TOM20 may act as a chaperone preventing these proteins from aggregation at the surface of mitochondria (PMID: 14699115).
What is TOM20's involvement in disease?
Diseases linked to the misregulation of TOM20 include Perry Syndrome and neurodegeneration with brain iron accumulation 2A. Numerous studies also associate deregulation of TOM20 with an array of mitochondrial dysfunctions and mitophagy defects (PMIDs: 30254015, 30160596).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TOM20 antibody 11802-1-AP | Download protocol |
| IF protocol for TOM20 antibody 11802-1-AP | Download protocol |
| IHC protocol for TOM20 antibody 11802-1-AP | Download protocol |
| IP protocol for TOM20 antibody 11802-1-AP | Download protocol |
| WB protocol for TOM20 antibody 11802-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Res AMPK targets PDZD8 to trigger carbon source shift from glucose to glutamine
| ||
Cell Res Mitochondria-localized cGAS suppresses ferroptosis to promote cancer progression | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Jade (Verified Customer) (02-03-2026) | It is efficient for Western Blotting
|
FH P (Verified Customer) (01-29-2026) | Very very good
![]() |
FH SK (Verified Customer) (01-29-2026) | Excellent
![]() |
FH Sai Sindhura (Verified Customer) (01-08-2026) | TOM20 antibody worked good in our colorectal cancer project.
|
FH Iram (Verified Customer) (12-19-2025) | Works well for WB
|
FH Antonijo (Verified Customer) (11-11-2025) | Previously, we used TOM20 from Santa Cruz Biotechnology at a dilution of 1:500 to obtain the signal, and the secondary antibody is mouse kappa. Because of the secondary antibody, we often could not use this antibody for immunofluorescence in combination with another antibody, such as NOXA, because the mouse kappa for this antibody is the same as the secondary. Since we use TOM20 from Proteintech, we obtain the signal at a dilution of 1:20000, the signal is much cleaner compared to other antibodies. Also, we can use this antibody for immunofluorescence in combination with other antibodies that have a mouse kappa secondary antibody because the TOM20 secondary antibody is rabbit.
![]() |
FH Pierre (Verified Customer) (09-26-2025) | Very Good
|
FH Ana (Verified Customer) (09-23-2025) | Worked great in Hela cells, could even do a higher dilution
|
FH Iram (Verified Customer) (09-18-2025) | Very good antibody.
|
FH Javier (Verified Customer) (09-09-2025) | Wb for assay.
|
FH karthik (Verified Customer) (08-28-2025) | Works well on cultured neurons fixed at room temperature or 37 *C. 0.1% triton x permeabilization for 10 minutes. Antibody incubated for 2 hours at room temperature.
![]() |
FH Kamile (Verified Customer) (07-23-2025) | WB worked very well on mouse hippocampal synaptosomes
![]() |
FH Anis (Verified Customer) (06-26-2025) | A549 cells, mitochondrial isolate 1:40 in antibody diluent 2 SimpleWestern
![]() |
FH Kateryna (Verified Customer) (01-16-2025) | The Tom20, a major marker of mitochondrial integrity, was assessed in the mouse hippocampal astrocytes. We measured the colocalization of Tom20 with the astrocytic marker GFAP. The incubation was 48 h at 4°C with the Tom20 antibody.
|
FH Durand (Verified Customer) (11-19-2024) | IF on HeLa cells using PFA 4%, 37°C 1h, BSA 10% 30 min, and 1h Ab 1/1000 dilution in BSA 3% Correct mitochondrial network
![]() |
FH PK (Verified Customer) (07-05-2024) | Excellent
![]() |
FH SD (Verified Customer) (07-05-2024) | Excellent
![]() |
FH Joel (Verified Customer) (11-07-2023) | Works well for immunofluorescence (1:200) and Western blotting (1:1000-1:2000)
|
FH Lisa (Verified Customer) (03-23-2023) | The antibody worked very well for immunofluorescence, combined with a secondary fluorescent antibody 555.
![]() |
FH S (Verified Customer) (12-12-2022) | excellent
![]() |
FH Kazu (Verified Customer) (11-22-2022) | This antibody works and provides robust signals of TOM20 immunoreactivity on feline tissue sections.
|
FH Wan (Verified Customer) (03-01-2022) | We got very clear and correct bands for tom20., very good antibody.
|
FH Süleyman (Verified Customer) (02-06-2022) | It is very specific and nicely labelled mitochondria. I highly suggest it. 4% paraformaldehyde fixation for 10 min at RT and 0.3% Triton-x100 10 minutes for permeabilization at RT. I used 2h at RT or 16h at 4 degree incubation. Alexa fluor 488 1:700 is used for 1 hour at RT for secondary ab.
![]() |
FH Sahil (Verified Customer) (10-09-2020) | The tom 20 works great. We wanted to compare and it does stand out
|
FH Thomas (Verified Customer) (09-18-2020) | The antibody allows for exceptionally clear visualisation of the mitochondrial outer membrane. HeLa cells were fixed in 4% PFA for 15 mins and permeabilised in 0.1% Triton-X 100 in PBS. Cells were blocked in 1% BSA. Primary antibody solution was diluted at 1:250 in blocking solution and incubated for 1 hour. Goat anti-rabbit 488 Alexa Fluor secondary antibody (1:250 - green) and DAPI (1:2000 - blue) were incubated with cells for 1 hour.
![]() |
FH Maria (Verified Customer) (06-05-2020) | TOM20 1:200 in PBST (0.1% triton) + 10% Donkey Serum O/N 4ºC incubation. Donkey anti-rabbit alexa fluor 555 1:500 1h RT incubation.
![]() |
FH Mohammad (Verified Customer) (02-25-2020) | For mouse hippocampusWorks well
|
FH Uxoa (Verified Customer) (02-18-2020) | TOM20 ab is great for ICC and WB. Tested in human primary fibroblats. ICC: fixed fibroblats with 4% PFA 15min. TOM20 diluted 1:200 in PBST (0.1% triton) + 10% DS O/N 4ºC incubation. Donkey anti-rabbit alexa fluor 488 1:500 1h RT. DAPI in blue.
![]() |
FH Benjamin (Verified Customer) (01-10-2020) | Reliably used in western blot where it identifies the correct band with high specificity.
|
FH Aamir (Verified Customer) (01-08-2020) | WB worked fine
|
FH Tanusree (Verified Customer) (12-03-2019) | This antibody works good in western blotting analysis using mouse tissues.
|
FH Fulong (Verified Customer) (10-24-2019) | It's great for IF.
|
FH Praveen (Verified Customer) (04-15-2019) | Good
![]() |
FH Daniela (Verified Customer) (03-19-2019) | A very specific and reliable antibody. For Western Blot, it identifies the correct MW band in cellular and mitochondrial lysate from either murine (N2a) and human (HeLa and U2OS) cell. For immunofluorescence, it is ideal for localization studies: it works perfectly to label mitochondria instead of plasmidic markers.
|
FH Svitlana (Verified Customer) (03-19-2019) | SDS-PAGE: 15 ug protein/well.Lines on WB1. BioRad Precision Plus Protein standard2. Homogenate of mice brain tissue3. Non-synaptosomal mitochondria from mice brain.Transfer: Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4CBlocking: SEA Block Blocking Buffer 1hSecondary Ab:IRDye 680LT Goat anti-Rabbit, 1h incubation at room temperature.
![]() |
FH Ken (Verified Customer) (02-06-2019) | It is an amazing antibody. Very specific and very bright at a 1:1000 dilution.
|






































