TOMM40L Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86943-1-RR (same clone as 86943-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86943-1-RR (TOMM40L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86943-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86943-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86943-1-RR against Human TOMM40L were performed. The affinity constant is 0.466 nM.

TOMM40L Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86943-1-PBS

Clone No.251895B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Protein TOMM40 like, Protein TOMM40-like, RP11 297K8.10, TOMM40B

---

Product Information

86943-1-PBS targets TOMM40L in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9401

  Product name: Recombinant human TOMM40L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-308 aa of BC014946

  Sequence: MGNTLGLAPMGTLPRRSPRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGDMDSSGSLNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPDLIGESVIMVAHFLQSLTHRLVLGGELVYHRRPGEEGAILTLAGKYSAVHWVATLNVGSGGAHASYYHRANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQANMVFRGLVDSNWCVGAVLEKKMPPLPVTLALGAFLNHWRNRFHCGFSITVG

• Full Name: translocase of outer mitochondrial membrane 40 homolog (yeast)-like
• Calculated Molecular Weight: 308 aa, 34 kDa
• Observed Molecular Weight: 33-38 kDa
• GenBank Accession Number: BC014946
• Gene Symbol: TOMM40L
• Gene ID (NCBI): 84134
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q969M1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TOMM40L (Mitochondrial import receptor subunit TOM40B) is a potential channel-forming protein implicated in the import of protein precursors into mitochondria.