Tested Applications
| Positive WB detected in | mouse testis tissue, HepG2 cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
25607-1-AP targets TOMM5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22275 Product name: Recombinant human TOMM5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-51 aa of BC034247 Sequence: MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI Predict reactive species |
| Full Name | translocase of outer mitochondrial membrane 5 homolog (yeast) |
| Calculated Molecular Weight | 51 aa, 6 kDa |
| Observed Molecular Weight | 6-10 kDa |
| GenBank Accession Number | BC034247 |
| Gene Symbol | TOMM5 |
| Gene ID (NCBI) | 401505 |
| RRID | AB_2880157 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8N4H5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TOMM5, also named as C9orf105 and TOM5, has three isoforms with MW 6 kDa and 9-10 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TOMM5 antibody 25607-1-AP | Download protocol |
| IHC protocol for TOMM5 antibody 25607-1-AP | Download protocol |
| WB protocol for TOMM5 antibody 25607-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Redox Rep TOM5 regulates the mitochondrial membrane potential of alveolar epithelial cells in organizing pneumonia | ||
bioRxiv Novel reporter of the PINK1-Parkin mitophagy pathway identifies its damage sensor in the import gate |







