TOMM5 Polyclonal antibody

• 

  WB analysis of mouse testis using 25607-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25607-1-AP (TOMM5 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 25607-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 25607-1-AP (TOMM5 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 25607-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 25607-1-AP (TOMM5 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 25607-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TOMM5 antibody (25607-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidine (red).

TOMM5 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25607-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

TOM5, RP11 263I4.1, C9orf105

---

Tested Applications

• Positive WB detected in: mouse testis tissue, HepG2 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

25607-1-AP targets TOMM5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22275

  Product name: Recombinant human TOMM5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-51 aa of BC034247

  Sequence: MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI

• Full Name: translocase of outer mitochondrial membrane 5 homolog (yeast)
• Calculated Molecular Weight: 51 aa, 6 kDa
• Observed Molecular Weight: 6-10 kDa
• GenBank Accession Number: BC034247
• Gene Symbol: TOMM5
• Gene ID (NCBI): 401505
• RRID: AB_2880157
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N4H5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TOMM5, also named as C9orf105 and TOM5, has three isoforms with MW 6 kDa and 9-10 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Redox Rep; TOM5 regulates the mitochondrial membrane potential of alveolar epithelial cells in organizing pneumonia; Authors - Yan Qian
	WB	bioRxiv; Novel reporter of the PINK1-Parkin mitophagy pathway identifies its damage sensor in the import gate; Authors - Julia A Thayer