Tested Applications
| Positive WB detected in | pig brain tissue, pig cerebellum tissue, rabbit cerebellum tissue, rat cerebellum tissue, SH-SY5Y cells, rabbit brain, rat brain, mouse brain, chicken brain |
| Positive IHC detected in | human lung tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Neuro-2a cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68048-1-Ig targets TPPP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit, chicken |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19046 Product name: Recombinant human TPPP protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-95 aa of BC131506 Sequence: MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTD Predict reactive species |
| Full Name | tubulin polymerization promoting protein |
| Calculated Molecular Weight | 219 aa, 24 kDa |
| Observed Molecular Weight | 24-29 kDa |
| GenBank Accession Number | BC131506 |
| Gene Symbol | TPPP |
| Gene ID (NCBI) | 11076 |
| RRID | AB_2918790 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O94811 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TPPP, also named as TPPP1, P24 and P25, belongs to the TPPP family. TPPP promotes in vitro the polymerization of tubulin into double-walled tubules and polymorphic aggregates or bundled stabilized microtubules blocks. When overexpressed, TPPP inhibits mitotic spindle assembly and nuclear envelope breakdown, apparently without affecting other cellular events.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TPPP antibody 68048-1-Ig | Download protocol |
| IHC protocol for TPPP antibody 68048-1-Ig | Download protocol |
| WB protocol for TPPP antibody 68048-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



















