TPPP Monoclonal antibody, PBS Only

• 

  WB analysis using 68048-1-Ig (same clone as 68048-1-PBS)

  Brain tissues were subjected to SDS PAGE followed by western blot with 68048-1-Ig (TPPP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68048-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 68048-1-Ig (same clone as 68048-1-PBS)

  WB result of TPPP antibody (68048-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TPPP transfected SH-SY5Y cells. This data was developed using the same antibody clone with 68048-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig cerebellum using 68048-1-Ig (same clone as 68048-1-PBS)

  pig cerebellum tissue were subjected to SDS PAGE followed by western blot with 68048-1-Ig (TPPP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68048-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit cerebellum using 68048-1-Ig (same clone as 68048-1-PBS)

  rabbit cerebellum tissue were subjected to SDS PAGE followed by western blot with 68048-1-Ig (TPPP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68048-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat cerebellum using 68048-1-Ig (same clone as 68048-1-PBS)

  rat cerebellum tissue were subjected to SDS PAGE followed by western blot with 68048-1-Ig (TPPP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68048-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 68048-1-Ig (same clone as 68048-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 68048-1-Ig (TPPP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68048-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 68048-1-Ig (same clone as 68048-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 68048-1-Ig (TPPP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68048-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68048-1-Ig (same clone as 68048-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68048-1-Ig (TPPP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68048-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68048-1-Ig (same clone as 68048-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68048-1-Ig (TPPP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68048-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Neuro-2a using 68048-1-Ig (same clone as 68048-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed Neuro-2a cells using TPPP antibody (68048-1-Ig, Clone: 1E5F5 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 68048-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TPPP Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 68048-1-PBS

Clone No.1E5F5

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, rabbit, chicken

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

p25 alpha, p24, EC:3.6.5.-, 25 kDa brain-specific protein, 25 kDa brain specific protein

---

Product Information

68048-1-PBS targets TPPP in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit, chicken
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19046

  Product name: Recombinant human TPPP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-95 aa of BC131506

  Sequence: MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTD

• Full Name: tubulin polymerization promoting protein
• Calculated Molecular Weight: 219 aa, 24 kDa
• Observed Molecular Weight: 24-29 kDa
• GenBank Accession Number: BC131506
• Gene Symbol: TPPP
• Gene ID (NCBI): 11076
• RRID: AB_2918790
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O94811
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TPPP, also named as TPPP1, P24 and P25, belongs to the TPPP family. TPPP promotes in vitro the polymerization of tubulin into double-walled tubules and polymorphic aggregates or bundled stabilized microtubules blocks. When overexpressed, TPPP inhibits mitotic spindle assembly and nuclear envelope breakdown, apparently without affecting other cellular events.