TPPP3 Polyclonal antibody, PBS Only

• 

  WB analysis of HEK-293 cells using 15057-1-AP (same clone as 15057-1-PBS)

  WB result of anti-TPPP3 (15057-1-AP, 1:500) with HEK-293 cells (siRNA transfected with) by Dr. Yupeng Chen. (Negative control or TPPP3 specific siRNAs were transfected into HEK-293 cells with the final concentration of 20 nM. Forty eight hours after transfection, cells were lysed with RIPA buffer and subjected to SDS PAGE). This data was developed using the same antibody clone with 15057-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 15057-1-AP (same clone as 15057-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 15057-1-AP (TPPP3 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15057-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15057-1-AP (same clone as 15057-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15057-1-AP (TPPP3 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15057-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 15057-1-AP (same clone as 15057-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 15057-1-AP (TPPP3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15057-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 15057-1-AP (same clone as 15057-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15057-1-AP (TPPP3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15057-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TPPP3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15057-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Tubulin polymerization-promoting protein family member 3, TPPP/p20, p25gamma, p20, CGI-38

---

Product Information

15057-1-PBS targets TPPP3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7040

  Product name: Recombinant human TPPP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC000691

  Sequence: MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK

• Full Name: tubulin polymerization-promoting protein family member 3
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 19-20 kDa
• GenBank Accession Number: BC000691
• Gene Symbol: TPPP3
• Gene ID (NCBI): 51673
• RRID: AB_2878105
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BW30
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TPPP3 (tubulin polymerization promoting protein 3), also named as TPPP/p20, is a new member of the TPPP family which binds tubulin and induces tubulin polymerization and microtubule bundling.TPPP3 has been shown to play an important role in cell proliferation and may be implicated in tumorigenesis and metastasis (19633818). TPPP3 was also identified as specific marker for the connective tissues that envelope tendons due to its distinct expression in the developing tendon sheath (19235716). This antibody detects the 19-20 kDa TPPP3 in HeLa and PC-3 cells. The non-specific bands between 40 and 60 kDa were also occasionally observed.