TPPP3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TPPP3 Polyclonal antibody (15057-1-AP)

• Featured Product
• KD/KO Validated

TPPP3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15057-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

Tubulin polymerization-promoting protein family member 3, TPPP/p20, p25gamma, p20, CGI-38

• 

  WB analysis of HEK-293 cells using 15057-1-AP

  WB result of anti-TPPP3 (15057-1-AP, 1:500) with HEK-293 cells (siRNA transfected with) by Dr. Yupeng Chen. (Negative control or TPPP3 specific siRNAs were transfected into HEK-293 cells with the final concentration of 20 nM. Forty eight hours after transfection, cells were lysed with RIPA buffer and subjected to SDS PAGE).

• 

  WB analysis of PC-3 using 15057-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 15057-1-AP (TPPP3 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15057-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15057-1-AP (TPPP3 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 15057-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 15057-1-AP (TPPP3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 15057-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15057-1-AP (TPPP3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TPPP3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: PC-3 cells, HEK-293 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15057-1-AP targets TPPP3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7040

  Product name: Recombinant human TPPP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC000691

  Sequence: MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK

• Full Name: tubulin polymerization-promoting protein family member 3
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 19-20 kDa
• GenBank Accession Number: BC000691
• Gene Symbol: TPPP3
• Gene ID (NCBI): 51673
• RRID: AB_2878105
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BW30
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TPPP3 (tubulin polymerization promoting protein 3), also named as TPPP/p20, is a new member of the TPPP family which binds tubulin and induces tubulin polymerization and microtubule bundling.TPPP3 has been shown to play an important role in cell proliferation and may be implicated in tumorigenesis and metastasis (19633818). TPPP3 was also identified as specific marker for the connective tissues that envelope tendons due to its distinct expression in the developing tendon sheath (19235716). This antibody detects the 19-20 kDa TPPP3 in HeLa and PC-3 cells. The non-specific bands between 40 and 60 kDa were also occasionally observed.

Publications

What published studies show

TPPP3 Polyclonal antibody (Cat# 15057-1-AP) has 9 total citations published in Immunity, EMBO J, Stem Cell Res Ther, Cell Rep, Front Immunol, Acta Biochim Biophys Sin (Shanghai), iScience, Front Dement, and bioRxiv. Research fields span intestinal antimicrobial immunity, osteochondral differentiation, melanoma stem cell tumorigenesis, ovarian cancer drug resistance, breast cancer metastasis, NASH fibrosis, tendon injury, Lewy body dementia, and myocardial recovery.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse		Immunity; Intestinal Tuft-2 cells exert antimicrobial immunity via sensing bacterial metabolite N-undecanoylglycine.; Authors - Zhen Xiong
mouse	IF	EMBO J; GNAS/PKA signaling promotes aberrant osteochondral differentiation of Gli1+ tendon sheath progenitors; Authors - Lijun Chen
human	WB	Stem Cell Res Ther; Requirement of splicing factor hnRNP A2B1 for tumorigenesis of melanoma stem cells.; Authors - Mengqi Chu ; KD Validated
human	WB,IF	Cell Rep; Cisplatin resistance in an ovarian cancer model is mediated by microtubule dynamics regulator TPPP3 in synergy with tubulin code rewiring.; Authors - Sachi Horibata ; KO Validated
mouse	IF	Front Immunol; Integrated analyses of single-cell transcriptomics identify metastasis-associated myeloid subpopulations in breast cancer lung metastasis; Authors - Zhen Huang
mouse	IF	iScience; Dynamic changes of molecular pattern and cellular subpopulation in puncture-induced tendon injury model; Authors - Zizhan Huang