TREM2 Monoclonal antibody, PBS Only

TREM2 Monoclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 68723-1-PBS
Clone No.1F4H10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF-P, Indirect ELISA

Trem2c, Trem2b, Trem2a, TREM-2, TREM 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68723-1-PBS targets TREM2 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6843

Product name: Recombinant human TREM2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 22-222 aa of BC032362

Sequence: TVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRPSQGSHLPSCLSKEPLGRRNPLPTHFHPSPPGLHLSHQDSSSQRPLGCSLAWTEARDTSTQ

Predict reactive species
Full Name triggering receptor expressed on myeloid cells 2
Calculated Molecular Weight 222 aa, 25 kDa
Observed Molecular Weight26-32 kDa
GenBank Accession NumberBC032362
Gene Symbol TREM2
Gene ID (NCBI) 54209
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NZC2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TREM2 (triggering receptor expressed on myeloid cells 2) is a cell surface receptor belongs to TREM family that is expressed on osteoclast, dendritic cells, macrophages, nature killers, neutrophils and microglia (PMID: 19302484). TREM2 is localized predominantly in the Golgi complex, but also shuttles to and from the cell surface in endocytic and exocytic vesicles (PMID: 16675145). TREM2 associates with DAP12 to initiate the intracellular signalling cascade via an immunoreceptor tyrosine-based activation motif (ITAM) domain and tyrosine-kinases (PMID: 23977213). TREM2 has a calculated molecular mass of ~25kDa, but apparent molecular mass of ~40kDa (PMID: 24078628). In addition, TREM2 has a soluble form termed as sTREM-2 with molecular weights ranging between about 24kDa and 40kDa (PMID: 18790823). Loss-of-function mutations in either TREM2 or DAP12 can cause Nasu-Hakola disease (PMID: 19302484).

Loading...
||
New chat

Able

正在加载,请稍候...