TSPO/PBR Monoclonal antibody

• 

  WB analysis using 68137-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68137-1-Ig (TSPO/PBR antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis using 68137-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68137-1-Ig (TSPO/PBR antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis of Jurkat using 68137-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 68137-1-Ig (TSPO/PBR antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of NIH/3T3 using 68137-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using TSPO/PBR antibody (68137-1-Ig, Clone: 1D1F12 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

TSPO/PBR Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 68137-1-Ig

Clone No.1D1F12

Publications(3)

Host / Isotype

Mouse / IgM

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

TSPO, Peripheral-type benzodiazepine receptor, MBR, BZRP, 1D1F12

---

Tested Applications

• Positive WB detected in: K-562 cells, LNCaP cells, Jurkat cells, HeLa cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 2 publications below

Product Information

68137-1-Ig targets TSPO/PBR in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7475

  Product name: Recombinant human TSPO protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-169 aa of BC001110

  Sequence: MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE

• Full Name: translocator protein (18kDa)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC001110
• Gene Symbol: TSPO
• Gene ID (NCBI): 706
• RRID: AB_2923664
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Caprylic acid/ammonium sulfate precipitation
• UNIPROT ID: P30536
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TSPO, also named Peripheral-type benzodiazepine receptor (PBR), encodes the translocator protein, belonging to tryptophan-rich sensory protein family. The protein is mainly localized in the outer mitochondrial membrane and expressed in steroid-synthesizing tissues (PMID:32881658, PMID:1326278). TSPO is involved in the translocation of cholesterol from the outer to inner mitochondrial membrane (PMID:21119734). In response to injury, TSPO has a upregulated expression in the peripheral nervous system (PMID:32423330, PMID:23251719). TSPO is also as a biomarker in a non-invasive procedure including detecting the inflammation in the heart and atherosclerotic plaques (PMID:24402571).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Phytomedicine; Huangqi Guizhi Wuwu decoction alleviate Oxaliplatin-Induced Peripheral Neuropathy by adjusting the myelin regeneration; Authors - Xueying Yang
human	WB,IF	Adv Healthc Mater; Disruption of Ferroptosis Inhibition and Immune Evasion with Tumor-Activatable Prodrug for Boosted Photodynamic/Chemotherapy Eradication of Drug-Resistant Tumors; Authors - Tao Bi
human,mouse	WB,IF	Mater Today Bio; Hydrogel-mediated mitochondrial reprogramming for inducing cell death: a novel approach to overcoming gemcitabine resistance in pancreatic ductal adenocarcinoma; Authors - Qixin Zhao