TSPO Monoclonal antibody, PBS Only

• 

  WB analysis using 68137-1-Ig (same clone as 68137-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68137-1-Ig (TSPO/PBR antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68137-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68137-1-Ig (same clone as 68137-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68137-1-Ig (TSPO/PBR antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68137-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 68137-1-Ig (same clone as 68137-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 68137-1-Ig (TSPO/PBR antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68137-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 68137-1-Ig (same clone as 68137-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using TSPO/PBR antibody (68137-1-Ig, Clone: 1D1F12 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68137-1-PBS in a different storage buffer formulation.

TSPO Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 68137-1-PBS

Clone No.1D1F12

Host / Isotype

Mouse / IgM

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

TSPO/PBR, 1D1F12, BZRP, MBR, Peripheral-type benzodiazepine receptor

---

Product Information

68137-1-PBS targets TSPO in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7475

  Product name: Recombinant human TSPO protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-169 aa of BC001110

  Sequence: MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE

• Full Name: translocator protein (18kDa)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC001110
• Gene Symbol: TSPO
• Gene ID (NCBI): 706
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Caprylic acid/ammonium sulfate precipitation
• UNIPROT ID: P30536
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TSPO encodes the translocator protein, belonging to tryptophan-rich sensory protein family. The protein is mainly localized in the outer mitochondrial membrane and expressed in steroid-synthesizing tissues (PMID:32881658, PMID:1326278). TSPO is involved in the translocation of cholesterol from the outer to inner mitochondrial membrane (PMID:21119734). In response to injury, TSPO has a upregulated expression in the peripheral nervous system (PMID:32423330, PMID:23251719). TSPO is also as a biomarker in a non-invasive procedure including detecting the inflammation in the heart and atherosclerotic plaques (PMID:24402571).