UBE2A Polyclonal antibody

UBE2A Polyclonal Antibody for WB, IHC, ELISA
Cat No. 11080-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, ELISA

HHR6A, HR6A, RAD6 homolog A, RAD6A, UBC2, UBE2A, Ubiquitin carrier protein A, Ubiquitin protein ligase A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, COLO 320 cells, human kidney tissue, human placenta tissue
Positive IHC detected inhuman nasopharyngeal carcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 3 publications below

Product Information

11080-1-AP targets UBE2A in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1567

Product name: Recombinant human UBE2A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 22-152 aa of BC010175

Sequence: AGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWRDC

Predict reactive species
Full Name ubiquitin-conjugating enzyme E2A (RAD6 homolog)
Calculated Molecular Weight 17 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC010175
Gene Symbol UBE2A
Gene ID (NCBI) 7319
RRIDAB_2212040
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP49459
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UBE2A(Ubiquitin-conjugating enzyme E2 A) serves as the cognate E2-conjugating enzyme. It plays a critical role in regulating TP53 protein levels under both normal and stress conditions. UBE2A, UBE2B regulates TP53 levels in a "yin-yang" manner through a combination of two distinct mechanisms in mammalian cells(PMID:22083959). This protein has 3 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IHC protocol for UBE2A antibody 11080-1-APDownload protocol
WB protocol for UBE2A antibody 11080-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Cell Sci

A specific subset of E2 ubiquitin-conjugating enzymes regulate Parkin activation and mitophagy differently.

Authors - Fabienne C Fiesel
ratWB

Mol Med Rep

Yuan‑zhi‑san inhibits tau protein aggregation in an Aβ1‑40‑induced Alzheimer's disease rat model via the ubiquitin‑proteasome system.

Authors - Bin Li
mouseWB

Cell Rep

A program of successive gene expression in mouse one-cell embryos

Authors - Maki Asami

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Alexandra (Verified Customer) (03-20-2024)

I was searching for a Rad6 antibody is strong enough to visualize endogenous protein. This is it. Works pretty good with endogenous Rad6 and extremely good with transfected cell lisate (for that I recomend a higher dilution, with 1000x the signal can be too strong)

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Cell culture
  • Primary Antibody Dilution: 1000x
  • Cell Tissue Type: U2OS human osteosarcoma cell line
UBE2A Antibody Western Blot,Immunohistochemistry,Immunofluorescence,Immunoprecipitation,Cell culture validation (1000x dilution) in U2OS human osteosarcoma cell line (Cat no:11080-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...