UBE2A Polyclonal antibody

• 

  WB analysis of HEK-293 using 11080-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11080-1-AP (UBE2A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 11080-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 11080-1-AP (UBE2A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human kidney using 11080-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 11080-1-AP (UBE2A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 11080-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 11080-1-AP (UBE2A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human nasopharyngeal carcinoma using 11080-1-AP

  Immunohistochemical analysis of paraffin-embedded human nasopharyngeal carcinoma tissue slide using 11080-1-AP (UBE2A antibody) at dilution of 1:200 (under 40x lens)..

UBE2A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11080-1-AP

Publications(3)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, ELISA

Synonyms

HHR6A, HR6A, RAD6 homolog A, RAD6A, UBC2, UBE2A, Ubiquitin carrier protein A, Ubiquitin protein ligase A

---

Tested Applications

• Positive WB detected in: HEK-293 cells, COLO 320 cells, human kidney tissue, human placenta tissue
• Positive IHC detected in: human nasopharyngeal carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

11080-1-AP targets UBE2A in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1567

  Product name: Recombinant human UBE2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-152 aa of BC010175

  Sequence: AGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWRDC

• Full Name: ubiquitin-conjugating enzyme E2A (RAD6 homolog)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC010175
• Gene Symbol: UBE2A
• Gene ID (NCBI): 7319
• RRID: AB_2212040
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49459
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UBE2A(Ubiquitin-conjugating enzyme E2 A) serves as the cognate E2-conjugating enzyme. It plays a critical role in regulating TP53 protein levels under both normal and stress conditions. UBE2A, UBE2B regulates TP53 levels in a "yin-yang" manner through a combination of two distinct mechanisms in mammalian cells(PMID:22083959). This protein has 3 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Cell Sci; A specific subset of E2 ubiquitin-conjugating enzymes regulate Parkin activation and mitophagy differently.; Authors - Fabienne C Fiesel
rat	WB	Mol Med Rep; Yuan‑zhi‑san inhibits tau protein aggregation in an Aβ1‑40‑induced Alzheimer's disease rat model via the ubiquitin‑proteasome system.; Authors - Bin Li
mouse	WB	Cell Rep; A program of successive gene expression in mouse one-cell embryos; Authors - Maki Asami

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Alexandra (Verified Customer) (03-20-2024)

I was searching for a Rad6 antibody is strong enough to visualize endogenous protein. This is it. Works pretty good with endogenous Rad6 and extremely good with transfected cell lisate (for that I recomend a higher dilution, with 1000x the signal can be too strong)

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Cell culture
• Primary Antibody Dilution: 1000x
• Cell Tissue Type: U2OS human osteosarcoma cell line

UBE2A Antibody Western Blot,Immunohistochemistry,Immunofluorescence,Immunoprecipitation,Cell culture validation (1000x dilution) in U2OS human osteosarcoma cell line (Cat no:11080-1-AP)