CoraLite® Plus 488-conjugated UBE2C Monoclonal antibody

• 

  IF Staining of HeLa using CL488-66087

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 UBE2C antibody (CL488-66087, Clone: 1C12H8 ) at dilution of 1:200.

• 

  FC experiment of HeLa using CL488-66087

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human UBE2C (CL488-66087, Clone:1C12H8) (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

UBE2C Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-66087

Clone No.1C12H8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

UB E2C, EC:2.3.2.24, EC:2.3.2.23, E2 ubiquitin-conjugating enzyme C, 1C12H8

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66087 targets UBE2C in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19235

  Product name: Recombinant human UBE2C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-179 aa of BC016292

  Sequence: MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP

• Full Name: ubiquitin-conjugating enzyme E2C
• Calculated Molecular Weight: 179 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC016292
• Gene Symbol: UBE2C
• Gene ID (NCBI): 11065
• RRID: AB_3084203
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00762
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

UBE2C(Ubiquitin-conjugating enzyme E2 C) is also known as UBCH10 and belongs to the ubiquitin-conjugating enzyme family. It is highly expressed in a variety of human primary tumors, and it is able to promote cell proliferation and malignant transformation(PMID:18703417). UBE2C, along with the E3 ligase of the anaphasepromoting complex (APC), catalyzes the ubiquitination of mitotic cyclins A and B, as well as securin. UBE2C is essential for cell cycle progression, and mutation of its active site cysteine confers a dominant-negative phenotype(PMID:17217624).