UBE2D1/2/3/4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UBE2D1/2/3/4 Polyclonal antibody (28328-1-AP)

UBE2D1/2/3/4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28328-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, Rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

E2(17)KB2, PUBC1, UBC4, UBC4/5, UBC5B, UBCH4, UBCH5B, UBE2D1, UBE2D2, UBE2D3, UBE2D4, Ubiquitin carrier protein D2, Ubiquitin protein ligase D2

• 

  WB analysis using 28328-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28328-1-AP (UBE2D1/2/3/4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 28328-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28328-1-AP (UBE2D1/2/3/4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 28328-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 28328-1-AP (UBE2D2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 28328-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 28328-1-AP (UBE2D2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 28328-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28328-1-AP (UBE2D1/2/3/4 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 28328-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28328-1-AP (UBE2D1/2/3/4 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for UBE2D1/2/3/4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, MCF-7 cells, NIH/3T3 cells, mouse testis tissue, mouse kidney tissue, rat kidney tissue, PC-12 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28328-1-AP targets UBE2D1/2/3/4 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28736

  Product name: Recombinant human UBE2D2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-59 aa of BC033349

  Sequence: MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTD

• Full Name: ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 14-17 kDa
• GenBank Accession Number: BC033349
• Gene Symbol: UBE2D2
• Gene ID (NCBI): 7322
• RRID: AB_2881114
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62837
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ubiquitination is a post-translational modification pathway or is part of the specific protein-degradation pathway by the 26S proteasome. Ubiquitination of a target protein involves multistep enzymatic reaction catalyzed by a cascade of enzymes including Ub-activating enzymes (E1s), Ub-conjugating enzymes (E2s) and Ub ligases (E3s) (PMID: 23542885). UBE2D family, which has 4 members named as UBE2D1/2/3/4, is an E2 ubiquitin-conjugating enzyme family in the ubiquitin-proteasome system. This antibody can recognize all the four members of UBE2D due to the high homology.

Publications

What published studies show

The UBE2D1/2/3/4 Polyclonal antibody (Cat# 28328-1-AP) has 1 citation, published in Nature Communications (IF 18.1). The cited study investigated CENP-F-dependent DRP1 function regulating APC/C activity during oocyte meiosis I, placing it in the fields of cell cycle regulation and reproductive cell biology. The antibody was used for Western blot in mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; CENP-F-dependent DRP1 function regulates APC/C activity during oocyte meiosis I; Authors - Cheng-Jie Zhou