Tested Applications
Positive WB detected in | HEK-293 cells, MCF-7 cells, NIH/3T3 cells, mouse testis tissue, mouse kidney tissue, rat kidney tissue, PC-12 cells |
Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
28328-1-AP targets UBE2D1/2/3/4 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.
Tested Reactivity | Human, Mouse, Rat |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28736 Product name: Recombinant human UBE2D2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC033349 Sequence: MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTD Predict reactive species |
Full Name | ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) |
Calculated Molecular Weight | 17 kDa |
Observed Molecular Weight | 14-17 kDa |
GenBank Accession Number | BC033349 |
Gene Symbol | UBE2D2 |
Gene ID (NCBI) | 7322 |
RRID | AB_2881114 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P62837 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ubiquitination is a post-translational modification pathway or is part of the specific protein-degradation pathway by the 26S proteasome. Ubiquitination of a target protein involves multistep enzymatic reaction catalyzed by a cascade of enzymes including Ub-activating enzymes (E1s), Ub-conjugating enzymes (E2s) and Ub ligases (E3s) (PMID: 23542885). UBE2D family, which has 4 members named as UBE2D1/2/3/4, is an E2 ubiquitin-conjugating enzyme family in the ubiquitin-proteasome system. This antibody can recognize all the four members of UBE2D due to the high homology.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for UBE2D1/2/3/4 antibody 28328-1-AP | Download protocol |
IHC protocol for UBE2D1/2/3/4 antibody 28328-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |