UBE2D1/2/3/4 Polyclonal antibody

• 

  WB analysis using 11677-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11677-1-AP (UBE2D1/2/3/4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11677-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11677-1-AP (UBE2D1/2/3/4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11677-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11677-1-AP (UBE2D3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 11677-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11677-1-AP (UBE2D1/2/3/4 antibody) at dilution of 1:1500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 11677-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11677-1-AP (UBE2D1/2/3/4 antibody) at dilution of 1:1500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

UBE2D1/2/3/4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11677-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

E2(17)KB3, UBC4/5, UBC5C, UBCH5C, UBE2D1, UBE2D1/2/3/4, UBE2D2, UBE2D3, UBE2D4, Ubiquitin carrier protein D3, Ubiquitin protein ligase D3

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse brain tissue, Hela cells, Jurkat cells, rat brain tissue, mouse kidney tissue, rat kidney tissue
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 9 publications below
• IHC: See 3 publications below

Product Information

11677-1-AP targets UBE2D1/2/3/4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2278

  Product name: Recombinant human UBE2D3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-147 aa of BC003395

  Sequence: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM

• Full Name: ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC003395
• Gene Symbol: UBE2D3
• Gene ID (NCBI): 7323
• RRID: AB_2256691
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61077
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ubiquitination is a post-translational modification pathway or is part of the specific protein-degradation pathway by the 26S proteasome. Ubiquitination of a target protein involves multistep enzymatic reaction catalyzed by a cascade of enzymes including Ub-activating enzymes (E1s), Ub-conjugating enzymes (E2s) and Ub ligases (E3s) (PMID: 23542885). UBE2D family, which has 4 members named as UBE2D1/2/3/4, is an E2 ubiquitin-conjugating enzyme family in the ubiquitin-proteasome system. This antibody can recognize all the four members of UBE2D due to the high homology.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Clr4SUV39H1 ubiquitination and non-coding RNA mediate transcriptional silencing of heterochromatin via Swi6 phase separation; Authors - Hyun-Soo Kim
human	WB	Sci Signal; Proteome-wide mapping of the Drosophila acetylome demonstrates a high degree of conservation of lysine acetylation.; Authors - Weinert Brian T BT
human	WB	Oncotarget; UBE2D3 gene overexpression increases radiosensitivity of EC109 esophageal cancer cells in vitro and in vivo.; Authors - Xiaojia Gao
human	WB	Am J Cancer Res; The E3 ubiquitin ligase RBCK1 promotes the invasion and metastasis of hepatocellular carcinoma by destroying the PPARγ/PGC1α complex.; Authors - Zheng Xu
human	IHC	Front Oncol; UBE2D3 Activates SHP-2 Ubiquitination to Promote Glycolysis and Proliferation of Glioma via Regulating STAT3 Signaling Pathway.; Authors - Zhenjiang Pan
human	IHC	Oncol Lett; UBE2D3 is a positive prognostic factor and is negatively correlated with hTERT expression in esophageal cancer.; Authors - Ge Ge Guan