UBOX5 Monoclonal antibody

• 

  WB analysis using 68422-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68422-1-Ig (UBOX5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 68422-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68422-1-Ig (UBOX5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

UBOX5 Monoclonal Antibody for WB, ELISA

Cat No. 68422-1-Ig

Clone No.2A7A4

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, ELISA

Synonyms

KIAA0860, RING finger protein 37, RNF37, U box domain containing 5, UBCE7IP5, UBOX5, UIP5

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Saos-2 cells, T-47D cells, SK-BR-3 cells, A549 cells, K-562 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68422-1-Ig targets UBOX5 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6573

  Product name: Recombinant human UBOX5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 196-541 aa of BC000515

  Sequence: QPAKTCSQEVIDSILLVTSENLPQDVALQAPALPMESDCDPGDQPESQQAPSSLQKLAEIIQDVPEEFLDPITLEIMPCPMLLPSGKVIDQSTLEKCNRSEATWGRVPSDPFTGVAFTPHSQPLPHPSLKARIDHFLLQHSIPGCHLLGRAQTALAVIPSSIVLPSQKRKIEQAEHVPDSNFGVNASCFSATSPLVLPTTSEHTAKKMKATNEPSLTHMDCSTGPLSHEQKLSQSLEIALASTLGSMPSFTARLTRGQLQHLGTRGSNTSWRPGTGSEQPGSILGPECASCKRVFSPYFKKEPVYQLPCGHLLCRPCLGEKQRSLPMTCTACQRPVASQDVLRVHF

• Full Name: U-box domain containing 5
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC000515
• Gene Symbol: UBOX5
• Gene ID (NCBI): 22888
• RRID: AB_3085137
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O94941
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.