UBOX5 Monoclonal antibody, PBS Only

• 

  WB analysis using 68422-1-Ig (same clone as 68422-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68422-1-Ig (UBOX5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68422-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68422-1-Ig (same clone as 68422-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68422-1-Ig (UBOX5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68422-1-PBS in a different storage buffer formulation.

UBOX5 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68422-1-PBS

Clone No.2A7A4

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

KIAA0860, RING finger protein 37, RNF37, U box domain containing 5, UBCE7IP5, UBOX5, UIP5

---

Product Information

68422-1-PBS targets UBOX5 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6573

  Product name: Recombinant human UBOX5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 196-541 aa of BC000515

  Sequence: QPAKTCSQEVIDSILLVTSENLPQDVALQAPALPMESDCDPGDQPESQQAPSSLQKLAEIIQDVPEEFLDPITLEIMPCPMLLPSGKVIDQSTLEKCNRSEATWGRVPSDPFTGVAFTPHSQPLPHPSLKARIDHFLLQHSIPGCHLLGRAQTALAVIPSSIVLPSQKRKIEQAEHVPDSNFGVNASCFSATSPLVLPTTSEHTAKKMKATNEPSLTHMDCSTGPLSHEQKLSQSLEIALASTLGSMPSFTARLTRGQLQHLGTRGSNTSWRPGTGSEQPGSILGPECASCKRVFSPYFKKEPVYQLPCGHLLCRPCLGEKQRSLPMTCTACQRPVASQDVLRVHF

• Full Name: U-box domain containing 5
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC000515
• Gene Symbol: UBOX5
• Gene ID (NCBI): 22888
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O94941
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.