UCP1 Recombinant monoclonal antibody

• 

  WB analysis of mouse brown adipose using 83870-1-RR

  mouse brown adipose tissue were subjected to SDS PAGE followed by western blot with 83870-1-RR (UCP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat brain using 83870-1-RR

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 83870-1-RR (UCP1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 83870-1-RR

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 83870-1-RR (UCP1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brown adipose using 83870-1-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brown adipose tissue using UCP1 antibody (83870-1-RR, Clone: 240782F3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brown adipose using 83870-1-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brown adipose tissue using UCP1 antibody (83870-1-RR, Clone: 240782F3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 83870-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83870-1-RR against Human UCP1 were performed. The affinity constant is 64.6 nM.

UCP1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 83870-1-RR

Clone No.240782F3

Publications(5)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

240782F3, SLC25A7, Thermogenin, UCP, UCP 1

---

Tested Applications

• Positive WB detected in: mouse brown adipose tissue
• Positive IHC detected in: rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brown adipose tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

83870-1-RR targets UCP1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20388

  Product name: Recombinant human UCP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-307 aa of BC098168

  Sequence: MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT

• Full Name: uncoupling protein 1 (mitochondrial, proton carrier)
• Calculated Molecular Weight: 307 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC098168
• Gene Symbol: UCP1
• Gene ID (NCBI): 7350
• RRID: AB_3671456
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P25874
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UCP-1 (Mitochondrial uncoupling protein 1), is a mitochondrial transporter protein that creates proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. It has been identified a key molecule for metabolic thermogenesis to avoid an excess of fat accumulation. UCP-1 expression is usually restricted to brown adipose when induced by cold exposure and thyroid hormone.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC, WB	Clin Transl Med; DNA-mediated UCP1 overexpression in adipose tissue: A promising anti-obesity gene therapy.; Authors - Ze-Wei Zhao
human, mouse	IHC, IF, WB	Neoplasia; White-to-brown adipose switching promotes bladder cancer progression.; Authors - Mingchao Gao
mouse	WB	Int J Antimicrob Agents; Amphotericin B ameliorates obesity through modulating gut mycobiome dysbiosis and brown adipose tissue thermogenesis in high-fat diet-induced mice.; Authors - Yinghan Xiang
mouse	WB	Food Res Int; Structural characterization of CYP-A from Chinese yam and its modulation of adipocyte lipolysis via the cAMP/PKA/HSL axis.; Authors - Xiaojun Li
mouse	WB	Adv Healthc Mater; Near-Infrared-II Photothermal Agents Targeting Lipid Droplets to Ameliorate Obesity Through Induction of Adipose Tissue Browning.; Authors - Shaofan Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Daniel (Verified Customer) (10-29-2025)

The antibody works great, I can recommend it

• Applications: Immunohistochemistry
• Primary Antibody Dilution: IHC-F 1:500
• Cell Tissue Type: mouse brown adipose tissue sections