Tested Applications
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84642-1-RR targets UNC79 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag35440 Product name: Recombinant human UNC79 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1740-1860 aa of NM_020818.4 Sequence: PLTLKQKRDLLQKSFALPEMSLDDHPDPGTEGEKPGELMPSSGAKTVLLKVPEDAENPTESEKPDTSAESDTEQNPERKVEEDGAEESEFKIQIVPRQRKQRKIAVSAIQREYLDISFNIL Predict reactive species |
| Full Name | KIAA1409 |
| Calculated Molecular Weight | 295 kDa |
| GenBank Accession Number | NM_020818.4 |
| Gene Symbol | UNC79 |
| Gene ID (NCBI) | 57578 |
| RRID | AB_3672101 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q9P2D8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UNC79 is one of the key auxiliary subunits of the NALCN channel complex. Together with NALCN, FAM155A, and UNC80, it constitutes the NALCN channel body and is essential for maintaining neuronal excitability, motor function, pain sensitivity, and circadian rhythm (PMID: 35387979).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for UNC79 antibody 84642-1-RR | Download protocol |
| IHC protocol for UNC79 antibody 84642-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







