UNC79 Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of mouse brain using 84642-1-RR (same clone as 84642-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84642-1-RR (UNC79 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84642-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 84642-1-RR (same clone as 84642-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84642-1-RR (UNC79 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84642-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 84642-1-RR (same clone as 84642-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using UNC79 antibody (84642-1-RR, Clone: 241628A7 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84642-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84642-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84642-1-RR against Human UNC79 were performed. The affinity constant is 11 nM.

UNC79 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 84642-1-PBS

Clone No.241628A7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

Protein unc-79 homolog, KIAA1409, 241628A7

---

Product Information

84642-1-PBS targets UNC79 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35440

  Product name: Recombinant human UNC79 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1740-1860 aa of NM_020818.4

  Sequence: PLTLKQKRDLLQKSFALPEMSLDDHPDPGTEGEKPGELMPSSGAKTVLLKVPEDAENPTESEKPDTSAESDTEQNPERKVEEDGAEESEFKIQIVPRQRKQRKIAVSAIQREYLDISFNIL

• Full Name: KIAA1409
• Calculated Molecular Weight: 295 kDa
• GenBank Accession Number: NM_020818.4
• Gene Symbol: UNC79
• Gene ID (NCBI): 57578
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9P2D8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UNC79 is one of the key auxiliary subunits of the NALCN channel complex. Together with NALCN, FAM155A, and UNC80, it constitutes the NALCN channel body and is essential for maintaining neuronal excitability, motor function, pain sensitivity, and circadian rhythm (PMID: 35387979).