UNG Polyclonal antibody

• 

  WB analysis using 12394-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12394-1-AP (UNG antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HuH-7 using 12394-1-AP

  WB result of UNG antibody (12394-1-AP; 1:3000; room temperature for 1.5 hours) with wild-type and UNG knockout HuH-7 cells.

• 

  IHC staining of human testis using 12394-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 12394-1-AP (UNG antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human testis using 12394-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 12394-1-AP (UNG antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 12394-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 12394-1-AP (UNG antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 12394-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 12394-1-AP (UNG antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 12394-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 12394-1-AP (UNG antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

UNG Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12394-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

DGU, EC:3.2.2.27, UNG1, Uracil-DNA glycosylase

---

Tested Applications

• Positive WB detected in: HT-29 cells, HuH-7 cells, HeLa cells
• Positive IHC detected in: human testis tissue, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

12394-1-AP targets UNG in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3072

  Product name: Recombinant human UNG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-304 aa of BC015205

  Sequence: MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL

• Full Name: uracil-DNA glycosylase
• Calculated Molecular Weight: 304 aa, 34 kDa
• Observed Molecular Weight: 28 kDa, 34-40 kDa
• GenBank Accession Number: BC015205
• Gene Symbol: UNG
• Gene ID (NCBI): 7374
• RRID: AB_10734597
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13051
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UNG(Uracil-DNA glycosylase) removes uracil in DNA resulting from deamination of cytosine or replicative incorporation of dUMP instead of dTMP. Thus, UNG plays a role in suppressing GC-to-AT transition mutations.The UNG gene encodes 2 isoforms that are individually targeted to the mitochondria and the nucleus(PMID:12369930). Defects in UNG are a cause of immunodeficiency with hyper-IgM type 5 (HIGM5).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Uracil processing by SMUG1 in the absence of UNG triggers homologous recombination and selectively kills BRCA1/2-deficient tumors; Authors - Daniele Musiani
human	WB	Dev Cell; Fam72a functions as a cell-cycle-controlled gene during proliferation and antagonizes apoptosis through reprogramming PP2A substrates; Authors - Yuan Fu