CoraLite® Plus 488-conjugated UNG Polyclonal antibody

• 

  IF Staining of HeLa using CL488-12394

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 UNG antibody (CL488-12394) at dilution of 1:200, CL594-Phalloidin (red).

UNG Polyclonal Antibody for IF/ICC

Cat No. CL488-12394

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

Uracil-DNA glycosylase, UNG1, EC:3.2.2.27, DGU

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-12394 targets UNG in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3072

  Product name: Recombinant human UNG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-304 aa of BC015205

  Sequence: MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL

• Full Name: uracil-DNA glycosylase
• Calculated Molecular Weight: 304 aa, 34 kDa
• Observed Molecular Weight: 28 kDa, 34-40 kDa
• GenBank Accession Number: BC015205
• Gene Symbol: UNG
• Gene ID (NCBI): 7374
• RRID: AB_3672538
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13051
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

UNG(Uracil-DNA glycosylase) removes uracil in DNA resulting from deamination of cytosine or replicative incorporation of dUMP instead of dTMP. Thus, UNG plays a role in suppressing GC-to-AT transition mutations.The UNG gene encodes 2 isoforms that are individually targeted to the mitochondria and the nucleus(PMID:12369930). Defects in UNG are a cause of immunodeficiency with hyper-IgM type 5 (HIGM5).