Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| CoIP | See 1 publications below |
| ChIP | See 1 publications below |
Product Information
66514-1-PBS targets USP7 in WB, IHC, IF/ICC, CoIP, ChIP, Indirect ELISA, CUT&Tag applications and shows reactivity with Human, rat, mouse samples.
| Tested Reactivity | Human, rat, mouse |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25652 Product name: Recombinant human USP7 protein Source: e coli.-derived, PET28a Tag: 6*His Sequence: MLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVK Predict reactive species |
| Full Name | ubiquitin specific peptidase 7 (herpes virus-associated) |
| Observed Molecular Weight | 128 kDa |
| Gene Symbol | USP7 |
| Gene ID (NCBI) | 7874 |
| RRID | AB_2881877 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q93009 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Differ Targeting the USP7-PRMT6 epigenetic axis overcomes chemoresistance in breast cancer by coordinating H3R2me2a deposition and RNF168 methylation for DNA repair and ferroptosis blockade.
|













