Product Information
66514-1-PBS targets USP7 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, rat, mouse samples.
Tested Reactivity | Human, rat, mouse |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25652 Product name: Recombinant human USP7 protein Source: e coli.-derived, PET28a Tag: 6*His Sequence: MLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVK Predict reactive species |
Full Name | ubiquitin specific peptidase 7 (herpes virus-associated) |
Observed Molecular Weight | 128 kDa |
Gene Symbol | USP7 |
Gene ID (NCBI) | 7874 |
RRID | AB_2881877 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q93009 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |