USP7 Monoclonal antibody, PBS Only

• 

  WB analysis using 66514-1-Ig (same clone as 66514-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66514-1-Ig (USP7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66514-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66514-1-Ig (same clone as 66514-1-PBS)

  WB result of USP7 antibody (66514-1-Ig; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-USP7 transfected HeLa cells. This data was developed using the same antibody clone with 66514-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 66514-1-Ig (same clone as 66514-1-PBS)

  WB result of USP7 antibody (66514-1-Ig; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-USP7 transfected A549 cells. This data was developed using the same antibody clone with 66514-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66514-1-Ig (same clone as 66514-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66514-1-Ig (USP7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66514-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66514-1-Ig (same clone as 66514-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66514-1-Ig (USP7 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66514-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66514-1-Ig (same clone as 66514-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66514-1-Ig (USP7 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66514-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66514-1-Ig (same clone as 66514-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 66514-1-Ig (USP7 antibody) at dilution of 1:100 and Alexa Fluor 488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66514-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

USP7 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66514-1-PBS

Clone No.3D7D11

Host / Isotype

Mouse / IgG2a

Reactivity

Human, rat, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Deubiquitinating enzyme 7, HAUSP, TEF1, Ubiquitin thioesterase 7, USP7

---

Product Information

66514-1-PBS targets USP7 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, rat, mouse samples.

• Tested Reactivity: Human, rat, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25652

  Product name: Recombinant human USP7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-93 aa of

  Sequence: MLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVK

• Full Name: ubiquitin specific peptidase 7 (herpes virus-associated)
• Observed Molecular Weight: 128 kDa
• Gene Symbol: USP7
• Gene ID (NCBI): 7874
• RRID: AB_2881877
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q93009
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.