Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, LNCaP cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, ROS1728 cells, NIH/3T3 cells, HepG2 cells, K-562 cells, 4T1 cells |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66514-1-Ig targets USP7 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25652 Product name: Recombinant human USP7 protein Source: e coli.-derived, PET28a Tag: 6*His Sequence: MLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVK Predict reactive species |
| Full Name | ubiquitin specific peptidase 7 (herpes virus-associated) |
| Observed Molecular Weight | 128 kDa |
| Gene Symbol | USP7 |
| Gene ID (NCBI) | 7874 |
| RRID | AB_2881877 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q93009 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for USP7 antibody 66514-1-Ig | Download protocol |
| IHC protocol for USP7 antibody 66514-1-Ig | Download protocol |
| WB protocol for USP7 antibody 66514-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
USP7 antibody (Cat# 66514-1-Ig) has 58 citations published across 45 journals, including Nature Communications, Cancer Cell, Science Translational Medicine, Advanced Science, Cell Death & Differentiation, Oncogene, Cell Reports, and EBioMedicine. Research fields predominantly cover oncology (breast, colorectal, liver, lung, ovarian, pancreatic, and prostate cancers), ferroptosis, immune regulation, cardiovascular disease, neurology, pulmonary injury, developmental biology, and virology.
| Species | Application | Title |
|---|---|---|
Cancer Cell Ubiquitination-directed cytosolic DNA degradation governs cGAS-STING-mediated immune response to DNA damage. | ||
Mol Cancer Immune-related deubiquitylation spectrum of microsatellite stability colorectal cancer reveals USP7 as a potential immunotherapeutic target. | ||
Autophagy MLKL-USP7-UBA52 signaling is indispensable for autophagy in brain through maintaining ubiquitin homeostasis | ||
Nat Commun The CTLH ubiquitin ligase substrates ZMYND19 and MKLN1 negatively regulate mTORC1 at the lysosomal membrane. | ||
Nat Commun All-trans retinoic acid destabilizes ADAR1 protein through retinoylation-mediated USP7 dissociation and improves immunotherapy in pancreatic cancer. | ||
J Adv Res Tetrahydrocurcumin targets TRIP13 inhibiting the interaction of TRIP13/USP7/c-FLIP to mediate c-FLIP ubiquitination in triple-negative breast cancer |
Reviews
What customers say
The single review for 66514-1-Ig is a 5-star rating from a user who tested the antibody by Western Blot on lung tissue at a 1:500 dilution (lot 10021424). The reviewer simply described the result as "Excellent," indicating strong performance and satisfaction with the product for this application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
S (Verified Customer) (06-17-2026) | Excellent
 |
