Tested Applications
Positive WB detected in | HeLa cells, A549 cells, LNCaP cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, ROS1728 cells, NIH/3T3 cells, HepG2 cells, K-562 cells, 4T1 cells |
Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:20000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 7 publications below |
WB | See 28 publications below |
IHC | See 4 publications below |
IF | See 7 publications below |
IP | See 5 publications below |
CoIP | See 4 publications below |
Product Information
66514-1-Ig targets USP7 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with Human, rat, mouse samples.
Tested Reactivity | Human, rat, mouse |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25652 Product name: Recombinant human USP7 protein Source: e coli.-derived, PET28a Tag: 6*His Sequence: MLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVK Predict reactive species |
Full Name | ubiquitin specific peptidase 7 (herpes virus-associated) |
Observed Molecular Weight | 128 kDa |
Gene Symbol | USP7 |
Gene ID (NCBI) | 7874 |
RRID | AB_2881877 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q93009 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for USP7 antibody 66514-1-Ig | Download protocol |
IHC protocol for USP7 antibody 66514-1-Ig | Download protocol |
IF protocol for USP7 antibody 66514-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Sci Transl Med Guanosine diphosphate-mannose suppresses homologous recombination repair and potentiates antitumor immunity in triple-negative breast cancer | ||
EBioMedicine CRIP1 involves the pathogenesis of multiple myeloma via dual-regulation of proteasome and autophagy | ||
J Adv Res Tetrahydrocurcumin targets TRIP13 inhibiting the interaction of TRIP13/USP7/c-FLIP to mediate c-FLIP ubiquitination in triple-negative breast cancer | ||
Cell Rep Increased degradation of FMRP contributes to neuronal hyperexcitability in tuberous sclerosis complex | ||
Oncogene The deubiquitinase USP7 regulates oxidative stress through stabilization of HO-1.
| ||
Ecotoxicol Environ Saf Role of the USP7/FOXO3A axis in environmentally relevant doses of arsenic-induced lung carcinogenesis: Insights from bioinformatics analysis and model of human epithelial cell malignant transformation |