UTP3 Polyclonal antibody, PBS Only

• 

  WB analysis using 18886-1-AP (same clone as 18886-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18886-1-AP (UTP3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18886-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 18886-1-AP (same clone as 18886-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18886-1-AP (UTP3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18886-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 18886-1-AP (same clone as 18886-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using UTP3 antibody (18886-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 18886-1-PBS in a different storage buffer formulation.

UTP3 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 18886-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Charged amino acid-rich leucine zipper 1, CRL1, CRLZ1, SAS10

---

Product Information

18886-1-PBS targets UTP3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13454

  Product name: Recombinant human UTP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 133-479 aa of BC004546

  Sequence: KKLYYDTDYGSKSRGRQSQQEAEEEEREEEEEAQIIQRRLAQALQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQYLRTKYNLYLNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPKPKSVSKTSAAACAVTDLSDDSDFDEKAKLKYYKEIEDRQKLKRKKEENSTEEQALEDQNAKRAITYQIAKNRGLTPRRKKIDRNPRVKHREKFRRAKIRRRGQVREVRKEEQRYSGELSGIRAGVKKSIKLK

• Full Name: UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)
• Calculated Molecular Weight: 479 aa, 55 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC004546
• Gene Symbol: UTP3
• Gene ID (NCBI): 57050
• RRID: AB_10597076
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQZ2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.