UTP3 Polyclonal antibody

• 

  WB analysis of A549 using 18886-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 18886-1-AP (UTP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 18886-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 18886-1-AP (UTP3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 18886-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 18886-1-AP (UTP3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 18886-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18886-1-AP (UTP3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 18886-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18886-1-AP (UTP3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A549 using 18886-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using UTP3 antibody (18886-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

UTP3 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 18886-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Charged amino acid-rich leucine zipper 1, CRL1, CRLZ1, SAS10

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, human brain tissue, mouse thymus tissue
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18886-1-AP targets UTP3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13454

  Product name: Recombinant human UTP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 133-479 aa of BC004546

  Sequence: KKLYYDTDYGSKSRGRQSQQEAEEEEREEEEEAQIIQRRLAQALQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQYLRTKYNLYLNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPKPKSVSKTSAAACAVTDLSDDSDFDEKAKLKYYKEIEDRQKLKRKKEENSTEEQALEDQNAKRAITYQIAKNRGLTPRRKKIDRNPRVKHREKFRRAKIRRRGQVREVRKEEQRYSGELSGIRAGVKKSIKLK

• Full Name: UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)
• Calculated Molecular Weight: 479 aa, 55 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC004546
• Gene Symbol: UTP3
• Gene ID (NCBI): 57050
• RRID: AB_10597076
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQZ2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.