VAMP2 Monoclonal antibody

VAMP2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67822-1-Ig
Clone No.1G7E8

Host / Isotype

Mouse / IgG3

Reactivity

Human, Mouse, Rat, Pig, Rabbit

Applications

WB, IHC, IF/ICC, ELISA

FLJ11460, SYB2, Synaptobrevin 2, VAMP 2, VAMP2

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrabbit brain tissue, pig brain tissue, rat brain tissue, mouse brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU-87 MG cells, SH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67822-1-Ig targets VAMP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit samples.

Tested Reactivity Human, Mouse, Rat, Pig, Rabbit
Host / Isotype Mouse / IgG3
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17908

Product name: Recombinant human VAMP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-116 aa of BC002737

Sequence: MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Predict reactive species
Full Name vesicle-associated membrane protein 2 (synaptobrevin 2)
Calculated Molecular Weight 13 kDa
Observed Molecular Weight19 kDa
GenBank Accession NumberBC002737
Gene Symbol VAMP2
Gene ID (NCBI) 6844
RRIDAB_2918585
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP63027
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VAMP2 (vesicle-associated membrane protein 2), also named as synaptobrevin 2, is a member of the SNARE (soluble NSF-attachment protein receptor) family proteins. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP2, with a molecular mass of 15-19 kDa, consists of a short N-terminal sequence, a SNARE motif, and a C-terminal transmembrane region. It is required for fast calcium-triggered synaptic vesicle fusion. VAMP2 forms a stable complex with STX1 (syntaxin 1) and SNAP25 (synaptosomal-associated protein 25) during synaptic vesicle fusion (PMID: 16793874). It also forms a distinct complex with synaptophysin. VAMP2 is expressed in nervous system and some non-neuronal tissues, such as skeletal muscle (PMID: 18570252).

Protocols

Product Specific Protocols
WB protocol for VAMP2 antibody 67822-1-IgDownload protocol
IHC protocol for VAMP2 antibody 67822-1-IgDownload protocol
IF protocol for VAMP2 antibody 67822-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Michela (Verified Customer) (06-20-2024)

The immunofluorescence was carried out in primary hippocampal neurons with an antibody dilution of 1:500. The antibody appears to be very specific and with minimal background staining.

  • Applications: Immunofluorescence, Cell culture
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Primary Hipppocampal Neurons
Loading...
||
New chat Able
正在加载,请稍候...