Tested Applications
| Positive WB detected in | rabbit brain tissue, pig brain tissue, rat brain tissue, mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U-87 MG cells, SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67822-1-Ig targets VAMP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit samples.
| Tested Reactivity | Human, Mouse, Rat, Pig, Rabbit |
| Host / Isotype | Mouse / IgG3 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17908 Product name: Recombinant human VAMP2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-116 aa of BC002737 Sequence: MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST Predict reactive species |
| Full Name | vesicle-associated membrane protein 2 (synaptobrevin 2) |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC002737 |
| Gene Symbol | VAMP2 |
| Gene ID (NCBI) | 6844 |
| RRID | AB_2918585 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P63027 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VAMP2 (vesicle-associated membrane protein 2), also named as synaptobrevin 2, is a member of the SNARE (soluble NSF-attachment protein receptor) family proteins. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP2, with a molecular mass of 15-19 kDa, consists of a short N-terminal sequence, a SNARE motif, and a C-terminal transmembrane region. It is required for fast calcium-triggered synaptic vesicle fusion. VAMP2 forms a stable complex with STX1 (syntaxin 1) and SNAP25 (synaptosomal-associated protein 25) during synaptic vesicle fusion (PMID: 16793874). It also forms a distinct complex with synaptophysin. VAMP2 is expressed in nervous system and some non-neuronal tissues, such as skeletal muscle (PMID: 18570252).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VAMP2 antibody 67822-1-Ig | Download protocol |
| IHC protocol for VAMP2 antibody 67822-1-Ig | Download protocol |
| WB protocol for VAMP2 antibody 67822-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Michela (Verified Customer) (06-20-2024) | The immunofluorescence was carried out in primary hippocampal neurons with an antibody dilution of 1:500. The antibody appears to be very specific and with minimal background staining.
|
