VAMP2 Monoclonal antibody

VAMP2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67822-1-Ig
Clone No.1G7E8

Host / Isotype

Mouse / IgG3

Reactivity

Human, Mouse, Rat, Pig, Rabbit

Applications

WB, IHC, IF/ICC, ELISA

FLJ11460, SYB2, Synaptobrevin 2, VAMP 2, VAMP2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrabbit brain tissue, pig brain tissue, rat brain tissue, mouse brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU-87 MG cells, SH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67822-1-Ig targets VAMP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit samples.

Tested Reactivity Human, Mouse, Rat, Pig, Rabbit
Host / Isotype Mouse / IgG3
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17908

Product name: Recombinant human VAMP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-116 aa of BC002737

Sequence: MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Predict reactive species
Full Name vesicle-associated membrane protein 2 (synaptobrevin 2)
Calculated Molecular Weight 13 kDa
Observed Molecular Weight19 kDa
GenBank Accession NumberBC002737
Gene Symbol VAMP2
Gene ID (NCBI) 6844
RRIDAB_2918585
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP63027
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VAMP2 (vesicle-associated membrane protein 2), also named as synaptobrevin 2, is a member of the SNARE (soluble NSF-attachment protein receptor) family proteins. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP2, with a molecular mass of 15-19 kDa, consists of a short N-terminal sequence, a SNARE motif, and a C-terminal transmembrane region. It is required for fast calcium-triggered synaptic vesicle fusion. VAMP2 forms a stable complex with STX1 (syntaxin 1) and SNAP25 (synaptosomal-associated protein 25) during synaptic vesicle fusion (PMID: 16793874). It also forms a distinct complex with synaptophysin. VAMP2 is expressed in nervous system and some non-neuronal tissues, such as skeletal muscle (PMID: 18570252).

Protocols

Product Specific Protocols
IF protocol for VAMP2 antibody 67822-1-IgDownload protocol
IHC protocol for VAMP2 antibody 67822-1-IgDownload protocol
WB protocol for VAMP2 antibody 67822-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Nat Protoc

Highly stable planar asymmetric suspended membranes for investigating protein dynamics and membrane fusion

Authors - Manindra Bera

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Michela (Verified Customer) (06-20-2024)

The immunofluorescence was carried out in primary hippocampal neurons with an antibody dilution of 1:500. The antibody appears to be very specific and with minimal background staining.

  • Applications: Immunofluorescence, Cell culture
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Primary Hipppocampal Neurons
Loading...
||
New chat

Able

正在加载,请稍候...