VAMP2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67822-1-Ig (same clone as 67822-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67822-1-Ig (VAMP2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67822-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67822-1-Ig (same clone as 67822-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67822-1-Ig (VAMP2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67822-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67822-1-Ig (same clone as 67822-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67822-1-Ig (VAMP2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67822-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-87 MG using 67822-1-Ig (same clone as 67822-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U-87 MG cells using VAMP2 antibody (67822-1-Ig, Clone: 1G7E8 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 67822-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 67822-1-Ig (same clone as 67822-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using VAMP2 antibody (67822-1-Ig, Clone: 1G7E8 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67822-1-PBS in a different storage buffer formulation.

VAMP2 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67822-1-PBS

Clone No.1G7E8

Host / Isotype

Mouse / IgG3

Reactivity

Human, Mouse, Rat, Pig, Rabbit

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

FLJ11460, SYB2, Synaptobrevin 2, VAMP 2, VAMP2

---

Product Information

67822-1-PBS targets VAMP2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit samples.

• Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit
• Host / Isotype: Mouse / IgG3
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17908

  Product name: Recombinant human VAMP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-116 aa of BC002737

  Sequence: MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

• Full Name: vesicle-associated membrane protein 2 (synaptobrevin 2)
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC002737
• Gene Symbol: VAMP2
• Gene ID (NCBI): 6844
• RRID: AB_2918585
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P63027
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VAMP2 (vesicle-associated membrane protein 2), also named as synaptobrevin 2, is a member of the SNARE (soluble NSF-attachment protein receptor) family proteins. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP2, with a molecular mass of 15-19 kDa, consists of a short N-terminal sequence, a SNARE motif, and a C-terminal transmembrane region. It is required for fast calcium-triggered synaptic vesicle fusion. VAMP2 forms a stable complex with STX1 (syntaxin 1) and SNAP25 (synaptosomal-associated protein 25) during synaptic vesicle fusion (PMID: 16793874). It also forms a distinct complex with synaptophysin. VAMP2 is expressed in nervous system and some non-neuronal tissues, such as skeletal muscle (PMID: 18570252).