CoraLite® Plus 488-conjugated VAMP2 Monoclonal antibody

VAMP2 Monoclonal Antibody for IF/ICC
Cat No. CL488-67822
Clone No.1G7E8

Host / Isotype

Mouse / IgG3

Reactivity

Human, Mouse, Rat, Pig, Rabbit

Applications

IF/ICC

FLJ11460, SYB2, Synaptobrevin 2, VAMP 2, VAMP2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inU-87 MG cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67822 targets VAMP2 in IF/ICC applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit samples.

Tested Reactivity Human, Mouse, Rat, Pig, Rabbit
Host / Isotype Mouse / IgG3
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17908

Product name: Recombinant human VAMP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-116 aa of BC002737

Sequence: MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Predict reactive species
Full Name vesicle-associated membrane protein 2 (synaptobrevin 2)
Calculated Molecular Weight 13 kDa
Observed Molecular Weight19 kDa
GenBank Accession NumberBC002737
Gene Symbol VAMP2
Gene ID (NCBI) 6844
RRIDAB_3084379
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP63027
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

VAMP2 (vesicle-associated membrane protein 2), also named as synaptobrevin 2, is a member of the SNARE (soluble NSF-attachment protein receptor) family proteins. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP2, with a molecular mass of 15-19 kDa, consists of a short N-terminal sequence, a SNARE motif, and a C-terminal transmembrane region. It is required for fast calcium-triggered synaptic vesicle fusion. VAMP2 forms a stable complex with STX1 (syntaxin 1) and SNAP25 (synaptosomal-associated protein 25) during synaptic vesicle fusion (PMID: 16793874). It also forms a distinct complex with synaptophysin. VAMP2 is expressed in nervous system and some non-neuronal tissues, such as skeletal muscle (PMID: 18570252).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 VAMP2 antibody CL488-67822Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...