VAMP3/Cellubrevin Monoclonal antibody, PBS Only (Capture)

VAMP3/Cellubrevin Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 66488-1-PBS
Clone No.1D10D10

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

VAMP3, 1D10D10, CEB, Cellubrevin, SYB3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66488-1-PBS targets VAMP3/Cellubrevin as part of a matched antibody pair:

MP51510-1: 66488-1-PBS capture and 66488-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1156

Product name: Recombinant human VAMP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-99 aa of BC005941

Sequence: MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCEMWAIGITVLVIFIIIIIVWVVS

Predict reactive species
Full Name vesicle-associated membrane protein 3 (cellubrevin)
Calculated Molecular Weight 11 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC005941
Gene Symbol VAMP3
Gene ID (NCBI) 9341
RRIDAB_2881853
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15836
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

VAMP3, also named cellubrevin or synaptobrevin 3, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. VAMP3 is a v-SNARE (soluble NSF-attachment protein receptor). Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP3 resides in recycling endosomes and endosome-derived transport vesicles, involved in regulating membrane traffic. It is implicated in recycling of transferrin receptors, secretion of alpha-granules in platelets, and membrane trafficking during cell migration.

Loading...
||
New chat

Able

正在加载,请稍候...