Product Information
66488-1-PBS targets VAMP3/Cellubrevin as part of a matched antibody pair:
MP51510-1: 66488-1-PBS capture and 66488-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1156 Product name: Recombinant human VAMP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC005941 Sequence: MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCEMWAIGITVLVIFIIIIIVWVVS Predict reactive species |
| Full Name | vesicle-associated membrane protein 3 (cellubrevin) |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 17 kDa |
| GenBank Accession Number | BC005941 |
| Gene Symbol | VAMP3 |
| Gene ID (NCBI) | 9341 |
| RRID | AB_2881853 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q15836 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
VAMP3, also named cellubrevin or synaptobrevin 3, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. VAMP3 is a v-SNARE (soluble NSF-attachment protein receptor). Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP3 resides in recycling endosomes and endosome-derived transport vesicles, involved in regulating membrane traffic. It is implicated in recycling of transferrin receptors, secretion of alpha-granules in platelets, and membrane trafficking during cell migration.









