VAMP3/Cellubrevin Monoclonal antibody, PBS Only

• 

  WB analysis of pig brain using 66488-1-Ig (same clone as 66488-1-PBS)

  Pig brain, rat brain and mouse brain tissues were subjected to SDS PAGE followed by western blot with 66488-1-Ig (VAMP3/Cellubrevin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66488-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66488-1-Ig (same clone as 66488-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66488-1-Ig (VAMP3/Cellubrevin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66488-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Neuro-2a using 66488-1-Ig (same clone as 66488-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed Neuro-2a cells using VAMP3/Cellubrevin antibody (66488-1-Ig, Clone: 1D10D10 ) at dilution of 1:1800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66488-1-PBS in a different storage buffer formulation.

VAMP3/Cellubrevin Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 66488-1-PBS

Clone No.1D10D10

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

VAMP3, Synaptobrevin-3, SYB3, Cellubrevin, CEB

---

Product Information

66488-1-PBS targets VAMP3/Cellubrevin in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1156

  Product name: Recombinant human VAMP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-99 aa of BC005941

  Sequence: MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCEMWAIGITVLVIFIIIIIVWVVS

• Full Name: vesicle-associated membrane protein 3 (cellubrevin)
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC005941
• Gene Symbol: VAMP3
• Gene ID (NCBI): 9341
• RRID: AB_2881853
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15836
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VAMP3, also named cellubrevin or synaptobrevin 3, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. VAMP3 is a v-SNARE (soluble NSF-attachment protein receptor). Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP3 resides in recycling endosomes and endosome-derived transport vesicles, involved in regulating membrane traffic. It is implicated in recycling of transferrin receptors, secretion of alpha-granules in platelets, and membrane trafficking during cell migration.