Tested Applications
| Positive WB detected in | pig brain tissue, HEK-293 cells, rat brain tissue, mouse brain tissue |
| Positive IF/ICC detected in | Neuro-2a cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:900-1:3600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66488-1-Ig targets VAMP3/Cellubrevin in WB, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, pig |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1156 Product name: Recombinant human VAMP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC005941 Sequence: MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCEMWAIGITVLVIFIIIIIVWVVS Predict reactive species |
| Full Name | vesicle-associated membrane protein 3 (cellubrevin) |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 17 kDa |
| GenBank Accession Number | BC005941 |
| Gene Symbol | VAMP3 |
| Gene ID (NCBI) | 9341 |
| RRID | AB_2881853 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q15836 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VAMP3, also named cellubrevin or synaptobrevin 3, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. VAMP3 is a v-SNARE (soluble NSF-attachment protein receptor). Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP3 resides in recycling endosomes and endosome-derived transport vesicles, involved in regulating membrane traffic. It is implicated in recycling of transferrin receptors, secretion of alpha-granules in platelets, and membrane trafficking during cell migration.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VAMP3/Cellubrevin antibody 66488-1-Ig | Download protocol |
| WB protocol for VAMP3/Cellubrevin antibody 66488-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
J Exp Clin Cancer Res Long non-coding RNA NORAD promotes the prostate cancer cell extracellular vesicle release via microRNA-541-3p-regulated PKM2 to induce bone metastasis of prostate cancer. | ||
Anim Reprod Sci Rheb ubiquitination drives LC3 lipidation via non-canonical autophagy to promote porcine sperm acrosome reaction. |





