VAMP4 Monoclonal antibody, PBS Only

• 

  WB analysis using 67219-1-Ig (same clone as 67219-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67219-1-Ig (VAMP4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67219-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 67219-1-Ig (same clone as 67219-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67219-1-Ig (VAMP4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67219-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 67219-1-Ig (same clone as 67219-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67219-1-Ig (VAMP4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67219-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 67219-1-Ig (same clone as 67219-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67219-1-Ig (VAMP4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67219-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 67219-1-Ig (same clone as 67219-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67219-1-Ig (VAMP4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67219-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 67219-1-Ig (same clone as 67219-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using 67219-1-Ig (VAMP4 antibody), at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67219-1-PBS in a different storage buffer formulation.

VAMP4 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67219-1-PBS

Clone No.3A6F2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

3A6F2, VAMP-4, Vesicle-associated membrane protein 4

---

Product Information

67219-1-PBS targets VAMP4 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27854

  Product name: Recombinant human VAMP4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-140 aa of BC007019

  Sequence: MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT

• Full Name: vesicle-associated membrane protein 4
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC007019
• Gene Symbol: VAMP4
• Gene ID (NCBI): 8674
• RRID: AB_2882510
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75379
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VAMP4 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP4 may play a role in trans-Golgi network to endosome transport.